(data stored in ACNUC1104 zone)

EMBL: CP002417.PE500

CP002417.PE500       Location/Qualifiers
FT   CDS_pept        539770..541368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0501"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   KEGG: hna:Hneap_2310 type II and III secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34723"
FT                   /db_xref="GOA:E6V4H7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H7"
FT                   /inference="protein motif:PFAM:PF00263"
FT                   /protein_id="ADU34723.1"
FT                   /translation="MNLKRCTLAATALCLVFQAEAQGPYPGAPAASPVPLGTVAPAPAF
FT                   SAPGAPAGARAETSPGIRPPAPPPSQASITEAELQRIAARATVLQRLPDLLTLYVGQMA
FT                   LVKMPGVSRVAIGNGKVMEARVLDGANMLITAQDAGDSTLHVWDKNGTVRKLKVRVNVA
FT                   DLERIADELREITRGISGVNIRRIGERIIMDGNSLDPAAVERLNTVAQLYAPAVVSLAT
FT                   ADRIRVDRMVDIQVRIVEFSKTALDDLGVRWQSSGDGFNFGLFSDIASSGSYRILPDGS
FT                   AFNTSTPQGTALLGQNRRMPEAYFGIGLSLTSRINLLVQRGNAFLLASPNLSTRSGGEA
FT                   KFLAGGEIPLPALSTQGAGSVEFKPYGVRLNIKPIADGEGNVSGSILTEVSSIDRSVAV
FT                   QGIPGLLIRRTDTEFNVKAGETIVLSGLLSRESTRSSDGVPGLRKTPIIGRAFRADNDT
FT                   DKEQEVVVFITPRVVGPADSRPRIERARELERDVGSNFGTLTEDKSDPNGSRPPAAAAD
FT                   IGGIPAGTPGQPVAP"
     atgaacctca agcgatgcac cttggcagcg acggcgctgt gtcttgtttt ccaggccgag        60
     gcgcagggtc cgtaccccgg cgcaccggcg gcatcgcccg tgccgctggg cacggtggcg       120
     cctgcgccgg ctttctcggc accgggcgcg ccggcagggg cccgcgctga aacttcgccg       180
     ggcatccgcc cacccgcgcc accgccctcg caggcctcca tcaccgaggc cgagctgcag       240
     cgcatcgccg cgcgcgccac cgtgctgcag cggctgcccg atctgctcac gctctacgtc       300
     ggccagatgg cgctggtcaa gatgccgggc gtctcgcgcg tggccatcgg caacggcaag       360
     gtgatggaag cccgcgtgct cgacggcgcg aacatgctca tcaccgcgca ggacgcgggc       420
     gacagcacgc tgcatgtctg ggacaagaac ggcaccgtgc gcaagctcaa ggtgcgggtg       480
     aacgtggccg acctggaacg catcgccgac gagctgcgcg agatcacgcg cggcatctcg       540
     ggcgtgaaca tccgccgcat cggcgagcgc atcatcatgg acggcaacag cctcgatccg       600
     gccgccgtcg agcgcctcaa tacggtggcg cagctctacg cgcccgcggt ggtgtcgctg       660
     gccacggccg accgcatccg cgtggaccgc atggtggaca tccaggtgcg catcgtcgag       720
     ttcagcaaga ccgcgctgga cgacctgggc gtgcgctggc agagctcggg cgacggcttc       780
     aatttcggcc tgttttccga catcgcctcc agcggcagct accgcatcct gcccgacggt       840
     tcggccttca acacttccac gccgcagggc acggcgctgc tgggccagaa ccggcgcatg       900
     ccggaggcgt acttcggcat cggcctcagc ctcacctcgc gcatcaacct cttggtgcag       960
     cgcggcaacg ccttcctgct tgcctcgccg aacctttcca cccgcagcgg cggcgaggcc      1020
     aagttcctgg ccggcggcga aatcccgctg cccgcgctca gcacgcaggg cgcgggttcg      1080
     gtcgagttca agccttatgg cgtgcggctg aacatcaagc ccatcgccga cggcgagggc      1140
     aacgtgtcgg gcagcatcct tacggaggtg agcagcatcg accgcagcgt ggcggtgcag      1200
     ggcattccgg gcctgttgat ccgccgcacc gacaccgagt tcaacgtgaa ggccggcgag      1260
     accatcgtgc tgtcggggct cctgagccgc gaatcgacgc gctccagcga cggcgtgccg      1320
     ggcctgcgca agacgccgat catcggccgc gccttccgtg ccgacaacga caccgacaag      1380
     gaacaggaag tggtggtgtt catcacgccg cgcgtggtcg gcccggcgga cagccgcccg      1440
     cgcatcgagc gcgcgcgcga actcgagcgg gacgtgggaa gcaacttcgg cacgctgacc      1500
     gaagacaagt cggacccgaa cggttcgcgc ccgcctgctg ctgccgcgga catcggcggc      1560
     atccccgccg gcacgcccgg ccagcccgtc gctccttaa                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page