(data stored in ACNUC1104 zone)

EMBL: CP002417.PE501

CP002417.PE501       Location/Qualifiers
FT   CDS_pept        541388..543031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0502"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: hna:Hneap_2309 FHA domain containing protein;
FT                   PFAM: type II secretion system protein E;
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34724"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H8"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADU34724.1"
FT                   /translation="MHKVFVNSPQQVVREVPIDVAELQVGKDAGNHIVLSGWNVAKLHA
FT                   QFVLHDEEVFVQDLGSLFGTWVDGNRVTRFGPMKGGEEIIIGGHTLVVSLDVALKPAGA
FT                   DPQEAAEAAQYAEAALAIEDPLLQWRRSLHRTLLQQLDNRRIDTAQMKDEELRSNIRAL
FT                   IAEVIRDTRDMPPELDRALLSQQLLDEAIGLGPLEVLLKDESVTEVMVNRFDEIWIERA
FT                   GRLERTNVAFTSNIAVLGAIERIVTPLGRRIDESSPMVDARLKDGSRVNAIIPPLALRG
FT                   PSVTIRKFPKNRMGHEGMIRTGSITAQMVDFMRIAVEEKLNIIVSGGTGTGKTTLLNMV
FT                   SNFIPPNERIVTIEDAAELSLGQPNLVSLESRPANIEGKGAIAIRDLVRNSLRMRPDRI
FT                   VVGECRGGEALDMLQAMNTGHDGSLTTLHSNSPRDAMSRLEVLVTMAGMNIPVAAIREQ
FT                   IASAVDLIVQLTRFPCGSRKVTQITEITGFADGMIQMQDVYAFRKTGVDDSFKTIGHFT
FT                   AAGTVPEFFTRLQEHGLKLDLEYLFGETTA"
     atgcacaagg tcttcgtcaa ttccccgcag caggtcgtgc gcgaggtccc gatcgatgtc        60
     gcggaactcc aggtcggcaa ggacgccggc aaccacatcg tgctgtcggg ctggaacgtc       120
     gcgaagctgc acgcccagtt cgtgctgcac gacgaggaag tgttcgtgca ggacctgggc       180
     agcctcttcg gcacctgggt cgatggcaac cgggtgacgc gcttcggccc gatgaagggc       240
     ggcgaggaaa tcatcatcgg cggccacacg ctggtggtgt cgctcgacgt ggcgctcaag       300
     cccgcgggcg ccgatccgca ggaggcggcc gaggcggcgc agtacgccga agcggcgctc       360
     gccatcgagg acccgctgct gcaatggcgc cgctcgctgc accgcacgct gctgcagcaa       420
     ctggacaacc gccgcatcga caccgcgcag atgaaggacg aggagctgcg ctccaacatc       480
     cgcgcgctga tcgccgaggt catccgcgac acgcgcgaca tgccgcccga actcgaccgc       540
     gcgttgctga gccagcaact gctggacgaa gccatcggcc tcggtccgct cgaagtgctg       600
     ctgaaagacg agagcgtgac cgaagtgatg gtcaaccgct tcgacgagat ctggatcgag       660
     cgcgcgggcc ggctggagcg caccaacgtt gccttcacca gcaacatcgc ggtgctcggc       720
     gccatcgagc gcatcgtgac gccgctgggc cggcgtatcg acgagagttc gccgatggtg       780
     gatgcgcgcc tgaaggacgg ctcgcgcgtg aacgcgatca ttccgccgct cgcgctgcgc       840
     ggacccagcg tcacgatccg gaaattcccg aagaaccgca tgggccacga ggggatgatc       900
     cgcaccggct ccatcaccgc gcagatggtg gacttcatgc gcatcgcggt ggaagagaag       960
     ctcaacatca tcgtctcggg cggcacaggc accggcaaga cgacgctctt gaacatggtg      1020
     tcgaacttca ttccgccgaa cgagcgcatc gtgaccatcg aggatgccgc cgagctctcg      1080
     ctgggccagc ccaacctggt gtcgctcgaa tcgcggcccg ccaacatcga aggcaagggc      1140
     gccatcgcga ttcgcgacct ggtgcgcaac tcgctgcgga tgcggcccga ccgcatcgtg      1200
     gtgggcgagt gccgcggcgg cgaggcgctg gacatgctgc aggccatgaa caccggccac      1260
     gacggctcgc tcaccacgct gcacagcaac tcgccgcgcg atgcgatgtc gcggctggaa      1320
     gtgctggtga cgatggcggg catgaacatc ccggtggcgg cgatccgcga gcagatcgcc      1380
     tcggcggtcg atctgatcgt gcagctcacg cgctttccgt gcggcagccg caaggtcacg      1440
     cagatcaccg agatcacggg ctttgccgac ggcatgatcc agatgcagga cgtgtacgcc      1500
     ttccgcaaaa ccggcgtgga cgacagcttc aagaccatcg gccacttcac cgccgcgggc      1560
     accgtgcccg agttcttcac gcgcctgcag gagcatggcc tgaagctcga cctggaatac      1620
     cttttcgggg agaccacggc atga                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page