(data stored in ACNUC1104 zone)

EMBL: CP002417.PE502

CP002417.PE502       Location/Qualifiers
FT   CDS_pept        543028..543885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0503"
FT                   /product="Type II secretion system F domain"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   bph:Bphy_4347 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34725"
FT                   /db_xref="GOA:E6V4H9"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H9"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADU34725.1"
FT                   /translation="MKGMILLASVLCGMGFITLCGYLLLQRSPELVGKMMSKLQASGRR
FT                   TLNLSEFQAQHAVAFASGHAFLVALCGAVGWLISGNLIGGVVAAVVLYLLPARWFAWQR
FT                   KKRRQQIESELPDALLFIASALRAGSALSVAIQVLVRDQVGPLGQEFGLVLKEQRLGVS
FT                   FDDAIQKMSQRLGIPDFVLVVVALRVSKEVGGNLSEPLQVLAETLRRKAILEGRIKALT
FT                   AQGRIQGLVMTLFPLLLMGVLYLMQPTMSLLFTTTIGWVVLTVIAIMLMLGYAMIRKIV
FT                   AIDI"
     atgaagggaa tgatcctgct ggcctccgtg ctctgcggca tgggcttcat cacgctgtgc        60
     ggctacctgc ttttgcagcg ctcgccggag ctggtcggca agatgatgag caagctgcag       120
     gcaagcggcc gccgcacgct gaacctctcg gagttccagg cgcagcatgc ggtggcgttc       180
     gcttcgggtc atgcatttct tgtggcgctg tgcggcgcgg tcggctggct catctcgggc       240
     aacctgatcg gcggcgtggt ggccgcggtg gtgctgtatc tcctgccagc gcgctggttc       300
     gcatggcaac gcaagaagcg caggcagcag atcgaatcgg agttgcccga tgcgctgctc       360
     ttcattgcga gcgcgctgcg cgccggcagc gcgctctcgg ttgcgattca ggttctggtg       420
     cgcgaccagg tcggcccgct cggccaggag ttcggcctgg tgctcaagga gcagcgcctg       480
     ggcgtgagct ttgacgacgc gatccagaag atgtcgcagc gcctcggcat ccccgacttc       540
     gtgctggtgg tggtggcgct gcgcgtctcc aaggaagtgg gcggcaatct gtcggagcct       600
     ctgcaggtgc tggccgagac gctgcggcgc aaagccattc tcgaaggccg catcaaggcg       660
     ctgacggcgc agggccgcat ccagggcctg gtgatgacgc tctttccgct gctcctgatg       720
     ggcgtgctct acctgatgca gccgaccatg tcgctcctgt tcaccacgac gatcggatgg       780
     gtcgtgctga ccgtgatcgc catcatgctg atgctgggct acgcgatgat ccgcaagatc       840
     gtcgccatcg atatctag                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page