(data stored in ACNUC1104 zone)

EMBL: CP002417.PE503

CP002417.PE503       Location/Qualifiers
FT   CDS_pept        543894..544784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0504"
FT                   /product="Type II secretion system F domain"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   slo:Shew_0642 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34726"
FT                   /db_xref="GOA:E6V4I0"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I0"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADU34726.1"
FT                   /translation="MRSLILLAIIFLCATTGVILLLYMISLIRKARPSERTHMDPLPRM
FT                   LRLVWPVVNILQFHVSEIAPTSMLVKRKRQLQLAGLEFVLKAEEFIAVQCVSMLIVAAL
FT                   GLWTAGLLDATAGTKIWVTLASCVTGWLYPVMWMRDRRKRREKDILRTLPGYLDMITLC
FT                   CQAGLSLTGAIAQAVQKGPGGALGQEFDRMMREMRTGASRMDALNALADRLDNKHIKSL
FT                   VSNLTQAESLGASLADTLSAISDQRRTERFQMAEKLAMEAPVKMIGPLVIFIFPVTFII
FT                   IFFPLVMQFLETQNH"
     atgcgctcgc tgatcctcct ggccatcatt ttcctgtgcg cgaccacggg cgtgatcttg        60
     ctgctctaca tgatctcgct gatccgcaag gcccggcctt cggagcgcac gcacatggac       120
     ccgctgccgc gcatgctgcg gctggtgtgg ccggtggtga acatcctgca gttccatgtg       180
     tcggagatcg cgccgacctc gatgctggtc aagagaaagc gccagttgca gctcgcgggc       240
     ctggagttcg tgctgaaggc cgaggagttc atcgcggtgc agtgcgtatc gatgctcatc       300
     gtcgccgcgc tcggtctctg gaccgcgggc ctgctcgacg ccaccgccgg taccaagatc       360
     tgggtcacgc tcgcgtcctg cgtgaccggg tggctctacc cggtgatgtg gatgcgcgac       420
     cgccgcaagc gccgcgagaa ggacatcctg cgcacgctgc caggctacct ggacatgatc       480
     acgctgtgct gccaggcggg cctgagcttg accggtgcca tcgcgcaggc ggtgcagaag       540
     ggccctggcg gcgcgctcgg ccaggagttc gaccggatga tgcgcgagat gcgcaccggc       600
     gcgagccgca tggacgcgct caacgcgctg gccgatcgcc tggacaacaa gcacatcaag       660
     agcctggtgt cgaacctcac gcaggccgag tcgctgggcg cgagcctggc cgacacgctc       720
     tcggccattt cggaccagcg ccgcaccgag cgtttccaga tggccgagaa gctcgcgatg       780
     gaagcgcccg tgaagatgat cgggccgctg gtgatcttca tctttccggt gaccttcatc       840
     atcatttttt tcccgctggt gatgcagttc ctcgaaacgc agaaccactg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page