(data stored in ACNUC1104 zone)

EMBL: CP002417.PE504

CP002417.PE504       Location/Qualifiers
FT   CDS_pept        544802..545143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0505"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   slo:Shew_0641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34727"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I1"
FT                   /inference="protein motif:PFAM:PF02643"
FT                   /protein_id="ADU34727.1"
FT                   /translation="MRIVSLRSPQAQPFGPVRVAERGWDRTRGLLGRPRLAASEGLLIM
FT                   RCSSVHTVGMRYPIDVVFLDRHGGIARVVESLRPMRVAMCLRAAHVLELAAGQARRLAL
FT                   RPGSKLSGW"
     atgcgcatcg tctccctccg ctccccccag gcccagccct tcggtcccgt gcgcgtggcc        60
     gaacgcggct gggaccgcac acgcgggctg ctcgggcggc cgcggctggc cgcgagcgag       120
     ggccttctga tcatgcgctg cagctcggtg cacacggtgg gcatgcgcta tccgatcgac       180
     gtcgtctttc tcgaccggca cggcggcatc gcgcgcgtgg tcgagagcct gcgcccgatg       240
     cgcgtggcca tgtgcctgcg cgcggcccac gtgctcgaac tggcggcggg ccaggcgcgg       300
     cggctcgcgc tgcgtccggg gtcgaagttg tcgggctggt aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page