(data stored in ACNUC1104 zone)

EMBL: CP002417.PE505

CP002417.PE505       Location/Qualifiers
FT   CDS_pept        545172..546353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0506"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: bpy:Bphyt_6880 TadE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34728"
FT                   /db_xref="GOA:E6V4I2"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I2"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ADU34728.1"
FT                   /translation="MHSTLQPKRRQRGVSMTETMIALPVLILFVMCVVQFGLIYRARLT
FT                   LEYAAHEAARAGSLNNGMPLPFIFRMGNSTVPGLSTLNSAALELTTNALTRGSVWQGLV
FT                   KGMMPLNVREASVGGMFKGWIDTNTDLIQSACIEYLNPTQTTFIDWAFIENFGQNRWIM
FT                   QIPNDTMRYRKPLPYDFKAKAMSTTVGIGDPLPPDAELRGNVSNKTLGEASVLHLRVHY
FT                   GYRLGIPVANKIILTALKGYQFVGEAWFKLMSTDGATAPGTDFRLNQLDAYYIANGKIP
FT                   LSAEGVAGMESPMFWHPFYSFGPRGDRSIELQWDPAWSNNLGINVLEKPQDAMTNIFAF
FT                   VRNNSTEWASQLLASGVDALADKVGDGNSFCPAIWDASVKGQLDQVPNPGKAP"
     atgcattcca cgcttcaacc caagcgccgc cagcgcggcg tctccatgac cgagaccatg        60
     atcgcgctgc cggtgctgat cctgttcgtg atgtgcgtgg tgcagttcgg cctcatctac       120
     cgcgcgcgcc tcacgctgga gtacgcggcg cacgaggccg cgcgtgcggg ctcgctcaac       180
     aacggcatgc cgctgccctt catctttcgc atgggtaact cgaccgtgcc gggcctctcc       240
     acgctcaaca gcgcggcgct ggagctcacc accaacgcgc tcacgcgcgg gagcgtgtgg       300
     caaggattgg tcaaggggat gatgccgctc aatgtgcgag aggccagcgt gggcggcatg       360
     ttcaagggct ggatcgacac caacaccgac ctcatccagt cggcctgcat cgagtacctg       420
     aatccgacgc agaccacgtt catcgactgg gccttcatcg agaacttcgg ccagaaccgc       480
     tggatcatgc agatccccaa cgacaccatg cgctaccgga agccgctgcc ctacgacttc       540
     aaggccaagg ccatgagcac caccgtgggc atcggcgatc cgctgccgcc cgatgcggaa       600
     ctgcgcggca acgtgtcgaa caagacgttg ggcgaagcca gcgtgctgca cctgcgcgtg       660
     cactacggct accgcctcgg gattccggtg gccaacaaga tcattctcac cgcgctcaag       720
     ggctaccagt tcgtgggcga ggcgtggttc aagctcatgt ccaccgacgg cgcgaccgcg       780
     cccggcaccg atttccgcct caaccagctc gatgcgtact acatcgccaa cggcaagatc       840
     cctttgtcgg ccgagggcgt ggcgggcatg gagtcgccga tgttctggca cccgttctat       900
     tcgttcggcc cgcggggcga ccgcagcatc gagctgcagt gggacccggc atggagcaac       960
     aatctcggca tcaacgtgct ggagaaaccg caggacgcca tgaccaacat cttcgccttc      1020
     gtgcgcaaca acagcaccga gtgggcctcg cagctgctgg ccagcggcgt cgacgcgctg      1080
     gccgacaagg tcggtgacgg caactccttc tgcccggcca tctgggacgc ctcggtcaag      1140
     ggccagctcg accaggtgcc gaacccgggc aaagcgccct ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page