(data stored in ACNUC1104 zone)

EMBL: CP002417.PE507

CP002417.PE507       Location/Qualifiers
FT   CDS_pept        complement(549628..551325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0509"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   vap:Vapar_0478 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34730"
FT                   /db_xref="GOA:E6V4I4"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I4"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADU34730.1"
FT                   /translation="MPTIIPFPARYSAFALCVVGLVACLAFVLVSPHLWLAWIGVAVFA
FT                   VLSGTGIHDLRQPRHAILRNYPVIGHLRFLLEFIRPEMRQYFIESDSEAAPFSRAQRSL
FT                   VYQRAKGEPDNRPFGTQLNVTIAGYEWINHSMQPTKLANHDFRIVIGGTPQPTDGNSAQ
FT                   VCTQPYSASVFNISAMSFGALSANAILALNQGAKMGGFAHDTGEGSISQHHRVHGGDLI
FT                   WEIGSGYFGCRNDDGSFNAERFTANARDPQVKMIEIKLSQGAKPGHGGVLPAPKVTPEI
FT                   AAARGVPVGVDCISPSSHSAFSTPTEMMHFVAKLRELSGGKPTGFKFCLGHPWEWFGIV
FT                   KAMQATGITPDFIVVDGAEGGTGAAPVEFSDHVGAPLQEGLLLVHNTLIGVNLRHRIKI
FT                   GCAAKVITAFDVARMMALGADWCNAARGFMMALGCIQAQSCHTGHCPTGVTTQDPLRQQ
FT                   ALVVPTKADRVRNFHRSTLHALQELVQAAGLDHPQQITAHHIVRRISDTEVRLLSNLVM
FT                   QVQPGALLGPLDAQHNVFRTYWPLASAESFQPVTQSPQGLVPGFAMAA"
     atgcccacga ttattccgtt tccggcgcgc tacagcgctt ttgccttgtg cgtggtcgga        60
     ctggtcgcct gcctggcctt cgtgctggtg tcgccgcatc tgtggctcgc gtggatcggc       120
     gtggcggtgt tcgcggtact ttcaggtacc ggcatccacg acctgcggca gccgcggcac       180
     gcgatccttc gcaactaccc ggtcatcggc cacctgcgct ttctgctgga attcatccgg       240
     cccgagatgc ggcagtactt catcgagagc gactcggaag cagccccgtt ctcgcgcgcg       300
     cagcgctcgc tggtctacca gcgcgccaag ggcgagccgg acaaccggcc gttcggcacc       360
     caactcaatg tgaccatcgc gggctacgag tggatcaacc attcgatgca gccgaccaag       420
     ctcgcgaacc acgatttccg catcgtgatc ggcggcacgc cgcagccgac cgatgggaac       480
     tccgcgcagg tctgcacgca gccgtacagc gccagcgtgt tcaacatctc ggccatgagt       540
     tttggcgcgc tgtcggccaa cgccatcctc gcgctcaacc agggcgccaa gatgggcggc       600
     ttcgcgcacg acaccggcga gggctcgatt tcgcagcacc accgggtgca tggcggcgac       660
     ctgatctggg aaatcggctc gggctacttc ggttgccgca acgacgacgg cagcttcaac       720
     gccgagcgct tcaccgccaa cgcgcgcgac ccgcaggtga agatgatcga gatcaagctg       780
     agccagggcg ccaagccagg ccacggtggc gtgcttcctg cccccaaagt cacgcccgag       840
     atcgcggccg cgcgtggcgt gccggtgggc gtggactgca tctcgccctc ctcgcacagc       900
     gcgttctcca cgccgaccga gatgatgcat ttcgtcgcga agctgcgcga gctctcgggc       960
     ggcaagccga cgggtttcaa gttctgcctc ggccatccgt gggaatggtt cggcatcgtc      1020
     aaggcgatgc aggcgaccgg catcacgccc gacttcatcg tggtcgacgg tgccgagggc      1080
     ggcacgggcg cggcaccggt cgagttcagc gaccacgtgg gcgcaccgct gcaagaaggt      1140
     ttgctgctgg tgcacaacac gctcatcggc gtgaacctgc gccaccgcat caagatcggc      1200
     tgcgccgcca aggtgatcac cgccttcgac gtggcccgca tgatggcgct gggcgccgac      1260
     tggtgcaacg cggcgcgcgg tttcatgatg gcgctgggct gcattcaggc gcagagctgc      1320
     cacaccggcc actgccccac gggcgtgacc acgcaggacc cgctgcgcca gcaggcgctg      1380
     gtggtgccga ccaaggccga ccgggtgcgc aacttccatc gcagcacgct gcatgcgctg      1440
     caagagctgg tgcaggccgc gggcttggat catccgcagc agatcaccgc ccaccacatc      1500
     gtgcgccgca tttccgacac cgaggtgcgc ctgttgagca acctggtgat gcaggtgcag      1560
     ccgggcgcgc tgctcgggcc gctcgatgcg cagcacaatg tctttcgtac ctactggccg      1620
     ctggccagtg cagagagttt tcagcccgtg acccaaagcc cgcaagggct tgtgccgggc      1680
     tttgcaatgg ccgcatga                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page