(data stored in SCRATCH zone)

EMBL: CP002417.PE509

CP002417.PE509       Location/Qualifiers
FT   CDS_pept        552169..553416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0511"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vap:Vapar_0480 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34732"
FT                   /db_xref="GOA:E6V5C6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU34732.1"
FT                   /translation="MPPSTGPESAAPLTPRAAWVMVLALCAGVALSQAFRTVGAIMASP
FT                   LQTDFKLSAQALGIFSGAFHFAFGAMQLFMGIGIDLHGVRRTVLVAFPIAIAGALLSAV
FT                   SSSYLVLVAGQALIGVGCAPAFLVCTVFIARHFPAARFATVSGMVLAIGGIGMLVTGTP
FT                   LAWLVEAYSWRAGFLVLAVAAALAWLAIWHWVHEPASAVPQVKESIPEAIRQFGALFAM
FT                   PHTLGIMVLGAVTYAAFISLRGLWLGPLMMERHGYSLVQSGNVALAVSVISLIGAPLFG
FT                   RLDRDGASRRRWIVICALVYAALFALIAVLHSAWLDIFGMVLIGVLSGFIVWQYADVRV
FT                   AYPVTLTGRAMAVFTMAMFLGVALMQWGTGVAASIAAAHGGDPLTAVLATIATLLVIGI
FT                   AAFAWLPAPKAVTVRS"
     gtgccgccta gcactggtcc ggagagcgcc gcgccgctga cgccgcgcgc ggcctgggtg        60
     atggtcctgg cgctctgcgc cggggtcgca ctcagccagg ccttccgcac agtcggcgcc       120
     atcatggcca gcccgctgca gacggatttc aagctctccg cccaggccct cggcatcttc       180
     tcgggggctt ttcatttcgc cttcggtgcg atgcagcttt tcatgggcat cggcatcgac       240
     ctgcacggcg tgcgccgcac ggtgctggtg gcctttccga tcgccatcgc gggcgcgctg       300
     ctctcggccg tgtcgtccag ctatctcgtg ctggtcgcgg ggcaggcgct gatcggcgtg       360
     ggctgcgcgc cggctttcct ggtgtgcacg gtcttcatcg cgcggcactt tccggcggcg       420
     cgcttcgcca ccgtgtcggg catggtgctc gccatcggcg gcatcggcat gctggtcacc       480
     ggtacgccgc tcgcgtggct ggtcgaggcg tattcgtggc gcgcggggtt cctcgtgctg       540
     gccgttgcgg ccgcgcttgc gtggctcgcg atctggcact gggtgcatga gcccgcgtcc       600
     gccgtgccgc aggtgaaaga gtcgattccg gaagcgatcc gccagttcgg cgcgctgttc       660
     gcgatgccgc acacgctggg catcatggtg ctcggcgcgg tgacgtatgc cgccttcatc       720
     tcgctgcggg gcttgtggct cgggccgctg atgatggagc gccacggcta ctcgctggtg       780
     cagagcggca acgtcgcgct ggctgtgtcg gtgatctcgc tcatcggcgc gccgctgttc       840
     gggcgcctcg accgcgatgg cgcatcgcgc cgccgctgga tcgtgatctg cgcgctggtc       900
     tatgccgcgc tcttcgcgct catcgccgtg ctgcactcgg cctggctcga catcttcggc       960
     atggtgctga tcggcgtgct ctcgggcttc atcgtgtggc agtacgccga tgtgcgcgtg      1020
     gcctatccgg tcacgctcac cgggcgcgca atggctgtct tcacgatggc gatgttcctc      1080
     ggcgtcgcgc tgatgcagtg gggcaccggc gtcgcggctt ccattgccgc ggcgcatggc      1140
     ggcgatccgc tcacggccgt gctggccacg atcgccacgc tgctggtgat cggcatcgcg      1200
     gccttcgcgt ggttgcccgc gccgaaggcc gtgactgtca gatcttga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page