(data stored in ACNUC1104 zone)

EMBL: CP002417.PE511

CP002417.PE511       Location/Qualifiers
FT   CDS_pept        complement(553717..554214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34734"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C8"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0482"
FT                   /protein_id="ADU34734.1"
FT                   /translation="MTAATNAQTIERFYSAFAKLDAATMEACYAPDAVFDDEAFSLRGR
FT                   REVGGMWRMLAGATKAKGADVWRLTFRDVQADDTTGSAHWDAHYRFSATGRLVDNSVDA
FT                   RFTFTPEGLIATHRDTFPFWTWSRQALGTPGLLLGWTPMLRNKVRATAAGNLSKFLSSQ
FT                   PS"
     atgacagcag ccaccaatgc ccagaccatc gagcgcttct acagcgcgtt cgccaagctc        60
     gacgccgcca ccatggaggc ctgctacgcg cccgacgcgg tgttcgacga cgaggccttt       120
     tccctgcgcg ggcggcgcga agtgggcggc atgtggcgca tgctggccgg cgccaccaag       180
     gccaagggcg cggacgtgtg gcgcttgacc tttcgcgacg tgcaggccga cgacaccacc       240
     ggcagcgccc actgggacgc gcactaccgc ttcagcgcca cgggccggct ggtggacaac       300
     agcgtcgatg cccgcttcac cttcacgccc gaggggctga tcgccacgca ccgcgacacc       360
     tttccgttct ggacctggtc gcgccaggcg ctcggcacgc cgggcctcct gctgggctgg       420
     acgccgatgc tgcgcaacaa ggtgcgcgcc acggcggccg gcaatctttc caaatttctt       480
     tcgagccaac cctcatga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page