(data stored in ACNUC1104 zone)

EMBL: CP002417.PE517

CP002417.PE517       Location/Qualifiers
FT   CDS_pept        complement(559268..560977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0519"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: bbr:BB0732
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34740"
FT                   /db_xref="GOA:E6V5D4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D4"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADU34740.1"
FT                   /translation="MNDTTLKADVLIIGAGPVGLTLAMDLASRGVSVIVCETRRFAEPP
FT                   NVKCNHVASRTMEQFRRLGVAQKLRDAGLPADYPNDVVFRTTVTGTELTRIPIPCRRDR
FT                   YTETEGPDAWWPTPEPPHRINQIYLEPILLKHTAALPGVQLLNRTQFAGFTQDREGVTA
FT                   IAIEMDSGVTRSIRCRYMVGCDGGSSVVRKQIGAKLEGTAVIQRVQSTFIRAPQLRDMI
FT                   PGKLAWSTYAMNPRRCGTMFAIDGHETWLVHNHLNAEEPEFDSVDRDQALRDILGVGPD
FT                   FQYEVISKEDWIGRRLVANRFREGRVFLAGDAAHLWVPYAGYGMNAGIADALNLSWLLG
FT                   ACVQGWGDEAMLDAYEAERQPITEQVSNFAMDHAQKMIRARRAVPQNIEAPGPEGDALR
FT                   ADIGSEAYALNVQQFCCAGLNFGYFYTGSPIIIADGEHTAPPYSMGDFTPSTVPGCRAP
FT                   HFWLADGRSLYDAFGPGYTLLRFDRSVDVRPLERAAQSYSMPLTVLDIETAEVPKVYAH
FT                   RLVLCRADQHVAWRGAHLPFDVYDFVAILRGDAKRVRERKRALAWEGVVAAA"
     atgaacgaca ccacactgaa ggccgacgtt ctcatcattg gcgcgggccc cgtgggcctc        60
     acgctggcca tggacctcgc atcgcgcggc gtctcggtga tcgtgtgcga gacccgccgc       120
     ttcgccgaac cgccgaacgt gaagtgcaac catgtggcct cgcgcaccat ggagcagttc       180
     cggcgcctgg gcgtggcgca gaagctgcgc gatgcgggcc tccccgccga ctaccccaac       240
     gacgtggtgt tccgcaccac cgtgacgggc acggagctca cgcgcattcc gattccgtgc       300
     cggcgcgacc gctacaccga gaccgagggg cccgacgcgt ggtggcccac gcccgagccg       360
     ccgcaccgca tcaaccagat ctacctggag cccatcctgc tgaagcacac ggcggcgctg       420
     ccgggcgtgc agttgctcaa ccgcacgcag ttcgcaggct tcacgcagga cagggaaggc       480
     gtgaccgcga tcgccatcga aatggacagt ggcgtcacgc gcagcatccg ctgccgctac       540
     atggtcggct gcgacggcgg cagctccgtg gtgcgcaagc agatcggcgc caagctcgaa       600
     ggcacggccg tcatccagcg cgtgcagtcg accttcatcc gcgcgccgca actgcgcgac       660
     atgatccccg gcaagctcgc gtggtcgacc tacgcgatga acccgcgccg ctgcggcacg       720
     atgttcgcca tcgacggaca cgagacctgg ctcgtgcaca accacctgaa tgccgaggag       780
     cccgagttcg attcggtcga ccgcgaccag gcgctgcgcg acatcctggg cgtgggcccc       840
     gattttcagt acgaggtcat cagcaaggaa gactggatcg gtcgccgcct cgtggccaac       900
     cgctttcgcg aaggccgcgt gttcctcgcg ggcgatgcgg cgcacctgtg ggtgccctac       960
     gcgggctacg gcatgaacgc gggcatcgcc gacgcgctca atctctcgtg gctgctgggc      1020
     gcctgcgtgc agggctgggg cgacgaggcg atgctggacg cctacgaggc cgagcgccag      1080
     ccgatcaccg agcaggtgtc gaacttcgcg atggaccatg cgcaaaagat gatccgcgcg      1140
     cgccgcgccg tgccgcagaa catcgaggcg cccggccccg agggcgatgc gctgcgcgcc      1200
     gacatcggca gcgaggccta cgcgctcaac gtgcagcagt tctgctgcgc cgggctgaac      1260
     ttcggctact tctacacggg ctcgccgatc atcatcgcgg acggcgagca caccgcgccg      1320
     ccctactcga tgggcgactt cacgccgtcc accgtgcccg gctgccgcgc gccgcacttc      1380
     tggctggccg acggccgctc gctgtacgac gcgttcggcc ccggctacac gctgctgcgc      1440
     ttcgaccgca gcgtggacgt gcggccgctg gagcgcgccg cgcagagcta cagcatgccg      1500
     ctcacggtgc tcgacatcga gaccgccgag gtgcccaagg tctacgccca ccgcctggtg      1560
     ctgtgccgcg cggaccagca cgtcgcctgg cgcggtgcgc acctgccgtt cgacgtgtac      1620
     gacttcgtcg ccatcctgcg cggcgatgcc aagcgggtgc gcgagcgcaa gcgggcgctg      1680
     gcttgggaag gcgtcgtcgc ggccgcctga                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page