(data stored in ACNUC1104 zone)

EMBL: CP002417.PE518

CP002417.PE518       Location/Qualifiers
FT   CDS_pept        complement(561022..562029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34741"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D5"
FT                   /inference="similar to AA sequence:KEGG:bll0408"
FT                   /protein_id="ADU34741.1"
FT                   /translation="MTASIARTAPSLRRQLLLATAFTLLAGTALAQAPAADFPSHPIRM
FT                   VVTFPPGGSADAVVRMLVPRLNEKLGQQVVVDNRPGAGGNVGLTLVAKAPADGYTLGLG
FT                   AAGALTANVNLYPQMPFDPVKDFKPVGMVAATPFVIVGHPSIGARTLRELIALAKAKPG
FT                   TLSMGHGGNGTAMHLSTALFAQMADVKLIEVPYRGSGPAALDAIAGQVQLALVDLPASL
FT                   QQIRAGKLIAFGVTSAQRVPMLPDVPTVAEAGLPGYDSTGWFGVVAPAGTPAPIVARLN
FT                   AELNAALGDEQIKASMRNLGAEPAPTSTEAFEAYIRSETKKWAKVIQVANIKLD"
     atgacagcat cgatcgcccg cacggcgcca tcgcttcgca ggcaattgct gctggccacg        60
     gccttcaccc tcctggccgg gaccgccctg gcacaggccc cggccgccga cttcccctcc       120
     catcccattc gcatggtcgt gacctttccg cccggcggga gcgcggacgc ggtggtgcgc       180
     atgctggtgc cgcggctcaa cgagaagctg gggcagcagg tggtggtgga caaccggccc       240
     ggcgccggtg gcaacgtggg cctcacgctg gtggcgaagg cgccggccga cggctacacg       300
     ctcggcctcg gcgcggcggg ggcgctcacc gccaatgtga acctttatcc gcagatgccc       360
     ttcgacccgg tgaaggactt caagccggtc ggcatggtcg ccgccacgcc gttcgtgatc       420
     gtcgggcatc cctccatcgg cgcgcgcacg ctgcgtgaac tgatcgcgct ggccaaggcg       480
     aagccgggca cgctctcgat gggccacggc ggcaacggca ccgcgatgca cctctcgacc       540
     gcgctcttcg cgcagatggc cgacgtgaag ctgatcgagg tgccctaccg cggctcgggc       600
     ccggccgcgc tcgatgcaat agccggccag gtgcagctcg cgctggtcga tctgcccgcc       660
     tcgctgcagc agatccgggc cggcaagctg atcgccttcg gggtgacgag tgcacagcgc       720
     gtgccgatgc tgcccgacgt gcccaccgtg gccgaagcgg gcctgccggg ctacgactcg       780
     accggctggt tcggcgtggt ggcaccggcc ggcacgcccg cgccgatcgt ggcgcggctc       840
     aacgcggagc tcaacgccgc gctcggcgac gagcagatca aggcctcgat gcgcaacctc       900
     ggcgcggagc ccgcaccgac atcgaccgag gccttcgagg cctacatccg cagcgagacg       960
     aagaagtggg ccaaggtgat ccaggtcgcc aacatcaagc tcgactga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page