(data stored in ACNUC1104 zone)

EMBL: CP002417.PE519

CP002417.PE519       Location/Qualifiers
FT   CDS_pept        562132..563040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0521"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bbr:BB0712 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34742"
FT                   /db_xref="GOA:E6V5D6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34742.1"
FT                   /translation="MNENFSPTFSPTIRQLRAFLAVHQLRKLSAAAQRLFVTQSAVSML
FT                   IRQLEEGLGTRLFDRTTRSLKPTAAANEMLPVAERILRDVDSLSTGFRELTTLERGRVS
FT                   VAITPTLATFLLPDAIRSFSQEHPKVRVLVNDCAPDQFISRILGEHVDFGIGTPERPGA
FT                   EVEVERLMRDHLALVCRDDHPLAKARVVRWTDLAGHPLITVRAGYGVRPLIDGTAADAG
FT                   VALDVVNEVSFLSSAIWMTAIGMGASIMPSAFARAANDPSLVVKVLSAPRVSRDISLVI
FT                   KRGHSLSVAARAFIAALKKSL"
     atgaatgaaa acttcagtcc tacgttcagc ccgacgatcc ggcagctgcg cgcattcctc        60
     gcggtgcacc agctgcgcaa gctgagcgcg gccgcgcaaa ggctcttcgt cacccagtcg       120
     gcggtgagca tgctgatccg ccagctcgag gagggcctgg gcacgcgcct gttcgaccgc       180
     accacgcgct cgctcaagcc gaccgcggcg gccaacgaaa tgctgcctgt ggccgagcgc       240
     atcctgcgcg acgtcgattc gctctccacc ggctttcgcg aactcaccac gctggagcgc       300
     ggccgcgtgt cggtggcgat cacgcccacg ctggccacct tccttttgcc cgatgcgatc       360
     cgcagcttca gccaggagca tccgaaagtt cgcgtgctgg tcaacgactg cgcgcccgac       420
     cagttcatct cgcgcatcct cggcgagcat gtggactttg gcatcggcac gcccgagcgg       480
     cccggtgccg aggtcgaggt cgagcggctc atgcgcgacc acctcgccct ggtgtgccgc       540
     gacgaccatc cgctcgccaa ggcacgcgtc gtgcgctgga ccgacctcgc cggccacccg       600
     ttgattaccg tgcgcgcggg ctacggcgtg cggccgctga tcgacggcac cgcggccgat       660
     gccggcgtgg cgctcgacgt ggtgaacgag gtgtcctttc tctcctccgc gatctggatg       720
     acggccatcg gcatgggcgc atcgatcatg ccctcggcct tcgcgcgcgc cgcgaacgat       780
     ccgtcgctgg tggtcaaggt gctcagcgcg ccgcgcgtct cgcgcgacat ctcgctggtc       840
     atcaagcggg ggcattcgct ctcggtcgcg gcgcgcgcct tcattgcggc actgaagaaa       900
     tctttgtag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page