(data stored in SCRATCH zone)

EMBL: CP002417.PE52

CP002417.PE52        Location/Qualifiers
FT   CDS_pept        55133..55747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0052"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   vap:Vapar_0047 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34275"
FT                   /db_xref="GOA:E6UXT1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT1"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADU34275.1"
FT                   /translation="MFGIADYGAFVVAIILFLLIPGPGNLALITSTSKGGIRGGLAATT
FT                   GLIVGDQCLLWAAVAGVSAVLAAYPTAFKAVQWLGAAYLAWLGFKMLLAKPGSAPILNI
FT                   KPGHFFRQAFMITLLNPKAIVFYMAFFPLFVDPARHQGLITFGAMAVTIAALTFLYGLT
FT                   STLLTHFLAERIRANRRISGTLEKLAGVFLIAFGVKLAISR"
     atgtttggca tcgctgacta cggcgcattt gtcgtcgcca tcatcctgtt cctcctgatt        60
     cccggcccgg gcaatctggc gctgatcacc tcgaccagca aaggcggaat tcgcggtgga       120
     ttggcagcga cgacgggtct gatcgtcggc gaccagtgcc ttttgtgggc cgcggtggcg       180
     ggcgtgtcgg cggttttggc cgcttacccg accgcattca aagcggtgca atggctgggc       240
     gccgcctatc tggcgtggct cggcttcaag atgctgctcg ccaagccggg ctcggccccg       300
     atcctcaaca tcaagccggg tcactttttc cgccaggcgt tcatgatcac cttgctgaac       360
     ccgaaggcca tcgtcttcta catggcgttc ttcccgctgt tcgtcgatcc ggcacggcat       420
     caaggcctga tcactttcgg cgcgatggca gtcacgattg cagcgctgac tttcctctac       480
     ggcctgacct cgacgctgct cacgcacttc cttgccgagc gcatccgtgc caatcgccgc       540
     atctccggca cgctcgaaaa gctggccggc gttttcctga tcgcctttgg cgtcaagctc       600
     gcgatctcgc gctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page