(data stored in ACNUC1104 zone)

EMBL: CP002417.PE521

CP002417.PE521       Location/Qualifiers
FT   CDS_pept        complement(563850..564809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0523"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; KEGG:
FT                   vap:Vapar_0487 thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34744"
FT                   /db_xref="GOA:E6V5D8"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D8"
FT                   /inference="protein motif:TFAM:TIGR01379"
FT                   /protein_id="ADU34744.1"
FT                   /translation="MGEFDLITRYFKRPAKRSPLGVGDDCALLAPAPGMQLAVSSDMLV
FT                   EGRHFLSTVEPSRLGHKALAVNLSDLAACGAKPLAFTLALALPGVDEHWLEGFSRGLFA
FT                   LADEHGCELVGGDTTRGPLNICITVFGEVPAGSALLRSGARAGDDIWVSGTLGDARLAL
FT                   EVFRGTIALPADVFAQARMRMEQPTPRVTLGQALRGIASSAVDVSDGLVGDLGHILGSS
FT                   NVGATLDVDAAVGTVAAAGTSALSVEMLRTCALSGGDDYELVFTAPSSARAAVEQAGKD
FT                   SATRVTRIGRIDAEAGLRIADASGAPVAQRFGSFDHFV"
     atgggtgaat tcgacctgat cacacgctat ttcaaacgcc ccgccaagcg ctccccgctg        60
     ggcgtcggcg acgactgcgc cttgctcgcg cccgcaccgg gcatgcagct cgccgtgtct       120
     tccgacatgc tggtcgaggg ccggcacttt ctctcgaccg tcgagccttc gaggctcggc       180
     cacaaggcgc tggcggtgaa cctcagcgac ctcgcggcct gtggcgcgaa gccgctggcc       240
     ttcacgctcg cgctcgcatt gccgggtgtg gacgagcact ggctcgaagg cttctcgcgc       300
     ggcctctttg cgctcgcgga cgaacacggc tgcgaactcg tgggtggcga caccacacgc       360
     ggcccgctca acatctgcat cacggtattc ggcgaagtgc cggccggctc ggcgctgctg       420
     cgttcgggcg ctcgggcggg cgacgacatc tgggtcagcg gcacgctcgg cgatgcgcgg       480
     ctggcgctcg aagtgttccg cgggacgatc gcgctgcctg ccgacgtgtt cgcacaggct       540
     cgcatgcgga tggagcaacc cacgccgcgc gtgacgctgg ggcaggccct gcgcggcatt       600
     gcttcgtcag cagtggatgt gagcgacggg ttggtcggcg acctggggca catcctcgga       660
     tcgagcaacg tgggcgccac gctcgatgtg gatgcggccg tgggcacggt ggctgcggcg       720
     ggcacgtccg cgctgagtgt cgagatgctg cgcacctgcg cgttgtcagg cggcgacgac       780
     tacgagcttg tattcaccgc accgtcctct gcgcgtgcag cagtcgagca ggccggcaag       840
     gacagcgcca cgcgcgtgac gcgcatcggt cgcatcgatg ccgaagcggg cctccgcatc       900
     gccgacgcaa gcggcgcgcc ggtggcgcag cgcttcggct cgttcgacca cttcgtctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page