(data stored in ACNUC1104 zone)

EMBL: CP002417.PE523

CP002417.PE523       Location/Qualifiers
FT   CDS_pept        complement(566161..567432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0525"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   vap:Vapar_0491 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34746"
FT                   /db_xref="GOA:E6V5E0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E0"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADU34746.1"
FT                   /translation="MNLTSFINDLLGFWSEWVRPSAGLPTVLWSLLLAAAAASGHLVQR
FT                   YLGLPKVIGYSLVGAVVGFAGFEGAIWPLRGISLFLLELGVAVVLFEAGGRLPLRWFRH
FT                   NPMVLVQSLLEATLTYFGVYWVLTLLGLPEPVANPIALMAIVASPAVLSRVIIDTRAAG
FT                   PVTERAMTLATLNTFYALALGYAQAGLIERAPQTMLQKLYPVAVVLGLSFVVGALMALA
FT                   LRSALRVMSPTSENTSILLLAIIAAGAALTAHVGGSAPLAALIGGVLLKTLNPKPWAWQ
FT                   RQLGTAASLLTMLMFVLVSIVAAQADWTLPVASVVLAVIGVRMIAKISGVAIANPGSGA
FT                   SWKQAFWVGCAMSPLSSIALLIASNFATASPLLGTMITQVALPSILLMEVVGAVLATVA
FT                   IHAVGESSVPWAPQAFSTTEDTQR"
     atgaatttga cgagcttcat caacgatctg ctgggcttct ggtccgaatg ggtgcgccct        60
     tcggcgggcc tgcccaccgt gctgtggtcg ctgctgctgg cggccgctgc ggcctccggc       120
     cacctggttc aacgctacct ggggctgccc aaggtgatcg gctattcgct ggtcggcgcg       180
     gtcgtcggct ttgccggctt cgaaggcgcg atctggccgc tgcgcggcat cagcctcttc       240
     cttcttgaac tgggcgtggc cgtggtgctg ttcgaggctg gcggccggct gccgctgcgc       300
     tggttccgcc acaacccgat ggtgctggtg cagagcctgc tcgaagccac actgacctac       360
     ttcggcgtgt attgggtgct cacgctgctg ggcctgcccg agccggtggc caacccgatc       420
     gcgctgatgg ccatcgtcgc ttcgccggcc gtgctgagcc gcgtgatcat cgacacgcgc       480
     gccgcgggcc ccgtcaccga acgcgcgatg acgctggcca cgctcaacac cttctacgcg       540
     ctcgcactcg gctacgcgca ggccggcctg atcgagcgcg caccgcagac gatgctgcag       600
     aagctctacc cggtggcggt ggtactcggc ctctcgttcg tggtcggtgc gctgatggcg       660
     cttgcgcttc gctccgcgtt gcgcgtgatg agcccgacga gcgagaacac ctcgatcctg       720
     ctgctggcga tcatcgcggc cggcgcggcg ctcaccgcgc acgtcggcgg ctcggcaccg       780
     cttgctgcgc tgatcggcgg cgtgctgctc aagaccctca atcccaagcc ctgggcatgg       840
     cagcggcaac tcggcaccgc cgcgtcgctg ctcaccatgc tgatgttcgt gctggtctcc       900
     atcgtggcgg cgcaagccga ctggacattg ccggtggcca gcgtggtgct ggccgtgatc       960
     ggcgtgcgca tgatcgccaa gatctccggc gtggccatcg ccaatcccgg cagcggcgcg      1020
     agctggaagc aggccttctg ggtcggctgc gcaatgtcgc cgctgtcgtc gatcgccctt      1080
     ttgatcgcat cgaatttcgc caccgcgtcg ccgctgctcg gcaccatgat cacgcaggtc      1140
     gccctgccgt cgatcctgct gatggaagtg gtcggcgccg tgctggccac cgtggccatt      1200
     cacgcggtcg gagagagttc ggtgccctgg gcgccccagg ccttcagcac caccgaggac      1260
     acgcagcgat ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page