(data stored in ACNUC1104 zone)

EMBL: CP002417.PE527

CP002417.PE527       Location/Qualifiers
FT   CDS_pept        complement(570682..570954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34750"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0495"
FT                   /protein_id="ADU34750.1"
FT                   /translation="MTQAKPSKTPPTDPKDPSKDAGGGKTKVEQGGESAPRLPHERDQS
FT                   SDSQQTQDGKPTKVGRQAHDDVERGVVDTDRGPEADRVYNDKIKR"
     atgacccaag ccaagcccag caagaccccg cccaccgacc cgaaagaccc gtcgaaggac        60
     gcgggcggcg gcaagaccaa ggtcgagcag ggcggcgaat cggcgccgcg cctgccgcac       120
     gagcgagacc agtcctcgga cagccagcag acccaggacg gtaaacccac caaggtaggc       180
     cgccaggcgc acgacgacgt ggaacgcggc gtggtcgaca ccgaccgcgg gccggaggcc       240
     gaccgcgtct acaacgacaa gatcaagcgc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page