(data stored in ACNUC1104 zone)

EMBL: CP002417.PE528

CP002417.PE528       Location/Qualifiers
FT   CDS_pept        571073..572110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0530"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: vap:Vapar_0496
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34751"
FT                   /db_xref="GOA:E6V5E5"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E5"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ADU34751.1"
FT                   /translation="MRRWKGLRNNPRMSSDPFAGVATDSLRIHTFASLHPGPRLLVIGG
FT                   VHGNETCGTAGIERILAEFDAGTLQLQRGELTLVPVANPLARRRLQREGERNLNRLFRP
FT                   TDEPADYEACITNRLAPVIARHEVLLDLHSFQSEGEAFAMIGPRDNTGTLEPFARSYEE
FT                   GQLALHIGTPIVVEGWLDIYAAGLAQRAGGAPADEAALDFGRGTNEYIRSCGGYGVTLE
FT                   CGQHDDPQAPEVAWRAIRRTLALLGMAALPPGLSGAPAQPPKLLRLASVTDRLHEEDSF
FT                   VRDWATFDEVRRGEPIGMRHDGTMLNAPDDGFIVFPNALALPGTEWFYFAHPSERVLGP
FT                   VTGTA"
     ttgcgccggt ggaagggcct ccgcaataat ccccgcatgt cttccgatcc ttttgccggc        60
     gtggcgaccg acagcctgcg catccacacc ttcgcctcgc tccaccctgg tccgcgcctg       120
     ctcgtgatcg gcggcgtgca cggcaacgag acctgcggca ccgcgggcat cgagcgcatc       180
     ctggccgagt tcgatgccgg cacgctgcag ttgcagcgtg gcgagctgac gctggtgccc       240
     gtggccaacc cgctcgcgcg ccggcgcctg cagcgcgaag gcgagcgcaa cctcaaccgc       300
     ctgttccgcc cgaccgacga acccgccgac tacgaagcct gcatcaccaa ccgcctcgcg       360
     ccggtcatcg cgcgccacga ggtgctgctc gacctgcact ccttccagag cgagggcgag       420
     gccttcgcga tgatcggccc gcgcgacaac accggcacgc tggagccctt cgcccgctcg       480
     tacgaagagg gccagctcgc gctgcacatc ggcacgccga tcgtggtgga aggctggctc       540
     gacatctacg ccgccggcct cgcgcagcgc gccggcggcg cgccggccga cgaggccgcg       600
     ctcgacttcg gccgcggcac caacgaatac atccgcagct gcggcggcta cggcgtcacg       660
     ctcgaatgcg gccagcacga cgacccccag gcgcccgagg tggcgtggcg cgccatccgc       720
     cgcacgctcg cgctgctggg catggccgcc ttgccgcccg ggctctcggg cgcgccggcg       780
     cagccgccga agctgctgcg cctggccagc gtgaccgacc ggctgcatga agaagacagc       840
     ttcgtgcgcg actgggccac cttcgacgag gtgcggcgcg gcgagcccat cggcatgcgc       900
     cacgacggca cgatgctgaa cgcgccggac gacggcttca tcgtgttccc caatgcgctc       960
     gcgctgccgg gcaccgagtg gttctacttc gcgcacccga gcgagcgcgt cctcgggccg      1020
     gtgaccggca cggcctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page