(data stored in ACNUC1104 zone)

EMBL: CP002417.PE529

CP002417.PE529       Location/Qualifiers
FT   CDS_pept        572176..573171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0531"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   vap:Vapar_0497 Ku protein; SMART: Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34752"
FT                   /db_xref="GOA:E6V5E6"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E6"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ADU34752.1"
FT                   /translation="MPVSKKAPAPRVLWKGAISFGLVHIPVALYSATTDHGIDFDWLDK
FT                   RSMDPVGYKRINKKTGKEITRENIVKGVEYEDGEYVVLSDKEIAAAYPKTTQTIEIETF
FT                   VPANGIPFVYLERPYYVAPINKGAKVYALLRETLQRSERVGVARVVIQTKQHLAVLVPV
FT                   GPGLVLNLLRWGADIRPWNDLPLPSEDAKKAGLTDRELKMAQQLVEDMSGEWDPMEYKD
FT                   EFKDEILRLVDRKVKAGQTETVTQPDPEEGQSTEGKGAKIIDLTELLQRSLRSKGGKTK
FT                   AVANDEDEDDDKEGDAPAPRAKPAARKRKPAAKAASKAASKTATRHRRAA"
     atgcccgtct cgaagaaagc ccccgcgccg cgcgtcctgt ggaagggcgc gatcagcttc        60
     ggcctcgtcc acatcccggt ggcgctctat tcggccacca ccgaccacgg catcgacttc       120
     gactggctcg acaagcgcag catggacccg gtcggctaca agcgcatcaa caagaagacc       180
     ggcaaggaaa tcacgcgcga gaacatcgtc aagggcgtgg agtacgagga cggcgagtac       240
     gtggtgctca gcgacaagga aatcgcggcc gcctatccca agaccacgca gaccatcgaa       300
     atcgagacct tcgtgcccgc gaacggcatt ccgttcgtgt acctggagcg gccctattac       360
     gtggcgccga tcaacaaggg cgcgaaggtc tacgcgctgc tgcgcgagac gctgcagcgc       420
     agcgagcgcg tgggcgtggc gcgcgtcgtg atccagacca agcagcacct ggcggtgctg       480
     gtgcccgtcg gccccggcct cgtgctgaac ctgctgcgct ggggcgccga catccgcccg       540
     tggaacgacc tgccgctgcc gtccgaagat gcgaagaagg cggggctcac cgaccgcgag       600
     ctcaagatgg cccagcagct cgtggaggac atgagcggcg agtgggaccc gatggaatac       660
     aaggacgagt tcaaggacga gatcctgcgg ctggtcgatc gcaaggtgaa ggcaggccag       720
     accgagacgg tgacgcagcc tgaccccgaa gagggccagt ccaccgaagg caagggcgcc       780
     aagatcatcg acctcaccga gctgctgcag cgcagcctgc gcagcaaggg cggcaagacg       840
     aaggccgtgg ccaacgatga ggacgaggac gacgacaaag aaggcgacgc gcccgcgcct       900
     cgcgccaagc cggcggccag gaagcgcaag cccgccgcaa aggccgcttc gaaagcggcc       960
     tcgaagaccg ccacacgcca tcgccgcgca gcctga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page