(data stored in ACNUC1104 zone)

EMBL: CP002417.PE530

CP002417.PE530       Location/Qualifiers
FT   CDS_pept        573184..575793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0532"
FT                   /product="DNA ligase D"
FT                   /note="KEGG: pol:Bpro_3003 ATP-dependent DNA ligase;
FT                   TIGRFAM: DNA ligase D; DNA polymerase LigD, ligase domain
FT                   protein; DNA ligase D, 3'-phosphoesterase domain protein;
FT                   DNA polymerase LigD, polymerase domain protein; PFAM: ATP
FT                   dependent DNA ligase; ATP dependent DNA ligase domain
FT                   protein; DNA primase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34753"
FT                   /db_xref="GOA:E6V5E7"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E7"
FT                   /inference="protein motif:TFAM:TIGR02776"
FT                   /protein_id="ADU34753.1"
FT                   /translation="MGTTRTASTARKALSRYHGKRDFSRTPEPKEGGRAGQGVLSFVIQ
FT                   KHHASRLHYDFRLELDGTLKSWAVPKGPCLDPTVKRMAVHVEDHPISYADFEGTIPPKQ
FT                   YGAGTVIVWDRGDWLPEGGSEADARKALAAGKLKFELRGEKLKGHWTLVRMRGKGDEKQ
FT                   EPWLLIKERDDAARDLADYDVLEEQPASVLTGRGLDEVDSPPKKAAPAKKAAAKKPEKK
FT                   AAKKEVKKEVKKKAALPATLQPQLAVLAASPPSSPDDWLYELKFDGYRLLARIDKGKVR
FT                   CFTRNGHDWTDKLPVIAKALAKLPTDSAWLDGEITVEGGNGAPDFQALQNAFDRGATSS
FT                   IVYWLFDAPFLDGQDLRDEPVEERRAHLARLLGKRPPATLRLSEAFDASPRDLLASSAR
FT                   IGFEGIVGKRKGSPYVSRRSADWIKLKNQQRQEFVIGGYTAPKGSRSGFGALLLGVHDD
FT                   KGRLRYCGNVGTGFNADRLADIKARLDRLATDDCPFKPMPDGANAKAQWVKPTLVAEVS
FT                   FGEWTREDRVRQAVFQGLRTDKPARGIVRERAAPSETSPETSTEASTDTPAKKQGARKS
FT                   MALKITHADRVIDAKSGITKGELAAYYDAVGTLMLPHLRGRPVSLVRAPDGVGGELFFQ
FT                   KHIQNREIPGVNLLDPALDPGHEPLLQIDSKTGLIGAAQMNVIELHTWNATSRAIDRPD
FT                   RMTFDLDPGEGVGWPQIQEATLLVRTLLDELGLPSFLKTSGGKGMHVVVPIRRQYGWDE
FT                   VKGFSQAVVVHLAKTIPDRFVAKSGPRNRVGKVFVDYLRNGFGATTVSAWSARSRPGLG
FT                   VSVPVAWEELPALTGAAQWTVANVAERLATGNKPWAAMERSRKGIAAAMKMLDYKPA"
     atgggaacaa cccgcaccgc atcgaccgcg cgcaaggcgc tttcccgcta ccacggcaag        60
     cgcgatttct cgcgcacgcc ggagcccaag gagggcggcc gcgcgggcca gggcgtgctc       120
     tccttcgtca tccagaagca ccacgcgagc cgcctgcact acgacttccg gctcgaactc       180
     gacggcacgc tcaagagctg ggccgtgccg aaaggaccgt gcctcgatcc gacggtcaag       240
     cgcatggcgg tgcatgtcga ggaccatccg atttcgtatg cggacttcga gggcaccatt       300
     ccgccgaagc aatacggtgc cggcaccgtc atcgtgtggg accgaggcga ctggctgccg       360
     gaggggggta gcgaagccga cgcgcgcaag gcgctcgcgg ccggcaagct caagttcgag       420
     ctgcgcggcg aaaagctcaa gggccactgg acgctggtgc gcatgcgcgg caagggcgac       480
     gagaagcaag agccgtggct gctcatcaag gagcgcgacg acgcggcgcg cgatcttgcc       540
     gattacgacg tgctcgaaga gcaacccgcg agcgtgctga ccggccgcgg cttggacgag       600
     gtggacagtc cgccgaagaa ggcggcgccc gccaaaaagg ccgcggcgaa gaagcccgag       660
     aagaaagcgg caaagaagga ggtcaagaag gaggtcaaga agaaggccgc cttgcccgcc       720
     acccttcaac cgcagctcgc ggtcctcgcc gcttcgcctc cgtcatcgcc cgacgactgg       780
     ctctacgaac tcaagttcga cggctaccgc ctgctcgcgc gcatcgacaa gggcaaggtg       840
     cgctgcttca cccgcaacgg ccatgactgg accgacaagc tgcccgtcat cgccaaggcc       900
     ctcgccaagc tacccaccga ttcggcctgg ctcgacggcg agatcaccgt ggaagggggc       960
     aacggcgcgc ccgatttcca ggcgctgcag aacgccttcg accgcggtgc gacttcatcc      1020
     atcgtctact ggctgttcga tgcgcccttt ctcgatgggc aggacctgcg cgacgagccg      1080
     gtcgaggagc gacgtgcgca cctggcccgc ctgctcggca agcggccacc ggcgacgctg      1140
     cgcctgagcg aggccttcga tgcgtcgccg cgcgacctgc ttgcgtcgtc cgcgcgcatc      1200
     ggcttcgagg gcatcgtcgg caagcggaag ggctcgccgt acgtgtcgcg ccgctcggcc      1260
     gactggatca agctcaagaa ccagcagcgc caggagttcg tgatcggcgg ctacaccgcg      1320
     cccaagggtt cgcgctcggg gttcggcgcg ctgctgctgg gcgtgcacga cgacaagggg      1380
     cggctgcgct attgcggcaa cgtgggcacc ggattcaacg cggatcggct cgccgacatc      1440
     aaggcgcggc tggacaggct ggccaccgac gactgtccct tcaagcccat gccggacggc      1500
     gcgaatgcga aggcgcaatg ggtcaagccc acgctggtgg ccgaagtctc tttcggcgaa      1560
     tggacgcgcg aagaccgcgt gcgccaggcg gtattccagg ggctgcgcac cgacaagccc      1620
     gcgcgcggca tcgtgcgcga acgggcggcg ccttccgaga catcgcccga gacatcaacc      1680
     gaagcatcaa ccgacacacc cgcgaagaag caaggagcaa ggaaatccat ggcgctgaag      1740
     atcacccacg ccgaccgcgt gatcgatgcg aagagcggca tcaccaaggg cgaactcgcc      1800
     gcctactacg acgcggtggg cacgctcatg ctgccgcacc tgcgcgggcg gccggtgtcg      1860
     ctggtgcgcg cgcccgacgg cgtgggcggc gagctgttct tccagaagca catccagaac      1920
     cgcgagatac ccggcgtcaa cctgctggac cccgcgctcg atccgggcca cgagccgctg      1980
     ctgcagatcg acagcaagac cgggctcatc ggcgccgcgc agatgaacgt catcgagctg      2040
     cacacctgga acgccacctc gcgcgccatc gaccggcccg accgcatgac cttcgacctg      2100
     gaccccggcg aaggcgtggg ctggccgcag atccaggaag cgacgctgct ggtgcgcacg      2160
     ctgctcgacg aactgggcct gccgtcgttc ctgaagacca gcggcggcaa ggggatgcat      2220
     gtggtggtgc cgatccgccg gcagtacggc tgggacgagg tcaaggggtt ctcgcaggcc      2280
     gtggtggtgc acctggcgaa gacgattccg gaccgcttcg tcgccaagag cgggccgcgc      2340
     aaccgcgtgg ggaaggtgtt cgtggattac ctgcgcaacg gcttcggcgc gaccacggtc      2400
     agcgcgtggt cggcgcggtc gcgcccgggg ctgggcgtgt cggtgccggt ggcgtgggag      2460
     gagttgcccg ccctgaccgg cgccgcgcaa tggaccgtcg ccaacgtggc cgagcgcctc      2520
     gccacgggca acaagccgtg ggcggcgatg gagcgcagcc gaaaaggcat cgccgcggcg      2580
     atgaagatgc tcgactacaa accggcgtag                                       2610
//

If you have problems or comments...

PBIL Back to PBIL home page