(data stored in SCRATCH zone)

EMBL: CP002417.PE531

CP002417.PE531       Location/Qualifiers
FT   CDS_pept        complement(575939..576757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0533"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: vap:Vapar_0499 transglutaminase domain
FT                   protein; PFAM: transglutaminase domain-containing protein;
FT                   SMART: transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34754"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E8"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADU34754.1"
FT                   /translation="MQIRIGYDIQLGVTAPTALIYMLQVHPSRAADIQGSEHITISPPL
FT                   VTDHYRDSFDNHCARVQVPLGVSSVRLRNTATVFDTGAPDPVDLGAIEHAPADLPVGTL
FT                   PFVLPSRYCEVDSELLQFAWANFANVAPGWNRVQAICNFVHGHLRFDYQNARATRTALE
FT                   GFREGTGVCRDFAHLAITLCRCMNIPARYVTGYLGDIGIPPVRYPMDFSAWFEVYLGDR
FT                   WHTFDARHNTPRIGRIVMARGRDAADVPITMVFGANTLERFDVTTEEVLQ"
     atgcagatca ggatcggcta cgacatccag ctgggcgtca ccgcccccac cgcgctgatc        60
     tacatgctgc aggtgcaccc ttcgcgcgcc gccgacatcc agggcagcga gcacatcacc       120
     atcagcccgc cgctggtcac cgaccattac cgcgacagct tcgacaacca ttgcgcgcgc       180
     gtgcaggtgc ctctgggcgt gagcagcgtg cggctgcgca acacggcgac cgtgttcgac       240
     accggcgcgc ccgacccggt cgacctgggc gccatcgagc acgcgccggc cgacctgccg       300
     gtgggcacat tgcctttcgt gctgcccagc cgctactgcg aggtcgacag cgaactgctg       360
     cagttcgcct gggccaactt cgcgaacgtg gcaccgggct ggaaccgcgt gcaggcgatc       420
     tgcaacttcg tgcacggcca cctgcgcttc gactaccaga acgcccgcgc cacacgcacc       480
     gcgctcgagg gctttcgcga gggcacgggc gtgtgccgcg acttcgcgca cctggcgatc       540
     acgctgtgcc gctgcatgaa cattccggcg cgctacgtga ccggctatct gggcgacatc       600
     ggcattccgc cggtgcgcta tccgatggac ttcagcgcgt ggttcgaggt gtacctgggc       660
     gaccgctggc acaccttcga tgcgcgccac aacacgccgc gcatcggccg catcgtgatg       720
     gcgcgcgggc gcgacgcggc ggacgtgccg atcacgatgg tgttcggcgc gaacacgctg       780
     gagcgcttcg atgtgacgac cgaagaagtg ctgcagtag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page