(data stored in ACNUC1104 zone)

EMBL: CP002417.PE535

CP002417.PE535       Location/Qualifiers
FT   CDS_pept        complement(581138..583189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0537"
FT                   /product="phospholipase D/transphosphatidylase"
FT                   /note="KEGG: bac:BamMC406_6428 phospholipase
FT                   D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34758"
FT                   /db_xref="GOA:E6V5F2"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F2"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_6428"
FT                   /protein_id="ADU34758.1"
FT                   /translation="MSDLRPTNDTQHRSTVPLCAATGAATGSAQWFLEKRGEDEKTPVF
FT                   HHNNLRLYICGEETFKQIATDIRRAQHSIDLVCWGFDPAMELTRETADQWPRGDTWGDL
FT                   LLGAAQGKFNNGKPVNVRLLVWYDFIGSAAVNNMPGYKTESLYERSKPGLLFPPSPSER
FT                   DRREIFNSHWYRDVVAGKQNALSLRTRGGVHDDVMTSLRSEASMNGLGRIERLGFEYLA
FT                   THHQKTIVIDYEGDKPCGYVLGLNSVTDYWDTTAHKFDDPRRGKSWEGANDAEPGLKPY
FT                   QDYGCRVEGQVLAAVCKNFTEAWNKAEGNGKGAGSNVSREFNLKATPANLTRNLVAPHQ
FT                   SAQILRTLPATDGSEKSIHRLYNHAISFARHYLYVENQYFQHAAWVKELKRLRGEYLAG
FT                   FQKGKLGMADVPKLHVMVLTPTPERKQMVPRTHDTVTELGHGSSMPNQTKLVEEEIARY
FT                   DAVQEARRRSRDPLMIPPPQPLSSIAQAYKDAGGGKDDEMARKALEGQFAMRSLVASLW
FT                   TFDTNWQTTQRDRLAKLDGWKKSANYDPNSPGYAGGINYIKDLENQLLKARYREIYIHS
FT                   KLMVIDDSMFTLGSANLNLRSFAVDSEINIASDDPVTAKNLRERVWGQHTDGKFAGGVA
FT                   TDQTVMAETFKNWRREAYKNFKKKALGEAPSCFLVAFHDDRASSIRLG"
     atgagcgacc tgcgaccaac gaacgacacg caacacagat cgaccgtccc cttatgcgcg        60
     gccacaggcg ccgccaccgg cagcgcgcaa tggtttctcg agaagagggg cgaagacgag       120
     aaaacaccgg tttttcatca caacaatttg cgcctctata tatgcggcga ggagaccttc       180
     aagcagatcg cgacggacat ccgaagagca cagcacagca tcgacctcgt ctgctggggc       240
     ttcgatcccg cgatggagct cactcgcgag acggccgacc aatggccgag gggtgacacc       300
     tggggcgatt tgctgctggg cgctgcgcag ggcaagttca acaacggaaa gccggtcaat       360
     gtgcgtcttc tggtgtggta cgacttcatc ggcagcgccg ccgtgaacaa catgccgggg       420
     tacaagaccg agtctctcta tgaacgcagc aaaccgggtt tgctgtttcc tccatctcct       480
     tccgagcgtg atcggcggga gatattcaat tcgcattggt acagggatgt cgtggcagga       540
     aagcagaacg ccctgtcgct gcgtacgcgc ggcggcgttc acgacgatgt gatgaccagt       600
     ctgaggagcg aagcgagcat gaatggcctg ggccgaatcg agcgcctggg cttcgaatac       660
     ctggccactc atcatcagaa aaccatcgtc atcgactatg aaggcgacaa accctgcggc       720
     tatgtgctcg gcctcaattc ggtcaccgac tactgggata ccacggctca caagttcgac       780
     gatcccaggc gtggcaagag ctgggaaggt gcaaacgacg cggagcccgg cctcaagccg       840
     tatcaggact acggctgccg tgtcgaggga caggtgctgg cggcggtgtg caagaacttc       900
     accgaggcgt ggaacaaggc cgaaggcaac ggcaaaggcg cgggcagcaa tgtgagccga       960
     gaattcaatc tcaaggccac gcctgcaaac ttgaccagga acctggtcgc tccgcatcag      1020
     agcgcgcaaa tcctgcgcac cttgcccgcc accgatggca gcgaaaagtc catccaccgc      1080
     ctctacaacc atgcgatcag cttcgcacgc cactacctgt atgtagagaa ccagtacttt      1140
     caacatgcgg cttgggtcaa ggaactgaag cgcttgcgtg gggagtactt ggcgggtttc      1200
     cagaaaggca aactgggcat ggctgacgtg cccaagctgc acgtgatggt cctgacgccc      1260
     acgccagagc gcaagcagat ggtgccgcgc acccacgaca ccgtgacaga gctggggcat      1320
     ggttcgtcca tgcccaatca gacaaagttg gtggaggagg aaatcgcgcg ctacgacgcc      1380
     gtacaagagg cccgcaggcg cagtcgggat ccgctcatga tccctccgcc ccaaccgctg      1440
     tccagcatcg cccaagccta caaggacgcg ggcggcggca aggacgacga gatggcgcgc      1500
     aaagcgctcg agggccagtt cgccatgcgc tcgctggtgg cgagcctgtg gaccttcgat      1560
     acgaactggc aaaccaccca gagagatagg ctggccaaac tcgacggatg gaagaagtca      1620
     gcgaactacg acccgaactc ccccggctac gccgggggca tcaactacat caaggatctg      1680
     gagaaccagt tgctcaaggc gcgttatcgc gagatctaca tccacagcaa gctgatggtc      1740
     atcgacgaca gcatgttcac gctgggcagc gcgaatttga acttgcgcag ctttgcggtg      1800
     gacagcgaga tcaatatcgc gagcgacgat ccggtcactg ccaagaatct gcgcgaacgg      1860
     gtgtgggggc agcacaccga cgggaagttc gcgggcgggg tggcgacgga tcagacggtg      1920
     atggcagaaa cgtttaaaaa ctggcgcaga gaggcctaca agaatttcaa gaagaaggcc      1980
     cttggcgaag ctccgtcttg tttcttggtc gcgttccacg acgaccgcgc cagcagcatc      2040
     cgcctgggtt ga                                                          2052
//

If you have problems or comments...

PBIL Back to PBIL home page