(data stored in ACNUC1104 zone)

EMBL: CP002417.PE536

CP002417.PE536       Location/Qualifiers
FT   CDS_pept        complement(583186..586020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0538"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="KEGG: mei:Msip34_1364 type VI secretion system Vgr
FT                   family protein; TIGRFAM: type VI secretion system Vgr
FT                   family protein; Rhs element Vgr protein; PFAM: Protein of
FT                   unknown function DUF2345"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34759"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F3"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ADU34759.1"
FT                   /translation="MQRTLSIQSPAIPVLLGQPTLEAVRLSGNEGINSLFAYELLLKTP
FT                   DALNLGASGAMDFDLDLFIGREITCLIQLDGAGQFVPSVAGQALDHIGAGVRQINALIT
FT                   DVEVWGEEGRHVQYKLTLRPWLHLATLTTDCRIYQNKTVVQILDELLASYDFPVDKRLI
FT                   ETYPTRDYQVQFNESDFEFFERLTQSWGISYFFQHSEGKHRLVLIDNMGAYRKNDSAAY
FT                   QKVEYHAPGWKVDAEYVSSFVPHHHLTSGRYASREYDYMRPRADLSQGRKEPRATGQAD
FT                   GEVYQWHEGSAAGSHYAQPRAGSAEANDPHGEGHRLALLRMEALRTHGARARASGNLRG
FT                   MVPGCSFQLTKHPRQKANAEYLLLDTRFLIEDVAQDSQIGDAAPGRKQQWKVEVDFTAH
FT                   PMAEPLRPVPTRPKPLTHGPQTARVVGPPGQNIWTDKWGRIKVQFPWDRIGNEDQHSSC
FT                   WIRVNLHGAGNQQGSIHVPRIGQEVIVDFVGGDPDLPICTGRVYNQANEPPWALPHHSA
FT                   LSGYRSRELTDNGGNSSAGRSNHIAMDDTKGKIQVQIKSDHQHSQLSLGHITRIEDNAG
FT                   RKDHRGQGLELRTDGHGAIRAAQGLLITTEGRANARAHITDMDETAARLTAAHEQHEGL
FT                   SGAALQTEAHSTGDQDEVIQSIKAQNDAIKSTAAAGKDRFPELADPHLVLASPAGIETT
FT                   TSQSTHIASAEHNALTSGGHTSVSAAKSFLVSAKQAVRLFAYQAGLRLFAFGGNIDIKA
FT                   LKESINILAKLDIVQVANRITITAKEELVLNGGGSTIRLNAAGIEDATSGKHVEHAAVH
FT                   SMVGPKNAPPRSVSGMSSLDLKKKGALSFVLLSHAQDGRPLGFEPYTLYRDGANVADGV
FT                   TDADGQVLIEDHQSDTTSYKVRLANGNEYELPVKAQLKSNDDRLAASGYRAAHSDTKNR
FT                   MQHYLRHRDDEGNS"
     atgcagcgca cgctctcgat tcagtctcct gcaattcctg tcctgctcgg acagccgacg        60
     ctggaagcgg ttcggctgtc aggaaacgaa gggatcaaca gcttgttcgc gtacgaactg       120
     ctcttgaaga cgcccgatgc actgaacctt ggcgccagcg gagcgatgga cttcgatctc       180
     gacctcttca tcggtcgcga gatcacctgc ttgatccagc tcgacggcgc ggggcagttt       240
     gttcccagcg ttgccggaca agccctcgac cacatcggcg caggcgtgcg ccagatcaac       300
     gcgctgatca ccgacgtgga agtctggggc gaagaggggc gccatgtgca atacaagctc       360
     acgctgcgtc cctggctgca cctggccacc ctcaccaccg actgcaggat ctatcagaac       420
     aagaccgtgg tccagatcct ggacgagctt cttgccagct acgactttcc cgtggacaag       480
     cgcctgatcg agacctaccc gacgcgggat taccaggttc agttcaacga gagcgacttt       540
     gaattcttcg agcgcctgac gcaatcctgg ggaatcagct acttcttcca gcacagcgag       600
     ggcaagcacc gcctggttct catcgacaac atgggggcct accggaagaa cgacagcgct       660
     gcataccaga aggtcgagta ccacgcgccg ggctggaagg tcgatgccga atacgtcagc       720
     agcttcgttc cgcatcacca cctgaccagc ggcaggtacg ccagccgcga gtacgactac       780
     atgcgcccca gggccgacct gagccagggc cgcaaggaac cgagagcgac gggccaggcc       840
     gatggcgagg tgtaccaatg gcatgaaggc agcgcggccg gcagccacta cgcgcagccc       900
     agggccggca gtgccgaggc gaacgatccc cacggcgaag gccaccggtt ggcgctcttg       960
     cgcatggagg cgctgcgcac ccacggcgcc agggcgcggg ccagcggcaa tttgcgcggc      1020
     atggtgcccg gctgctcctt tcaattgacc aagcacccgc gccagaaagc caatgccgaa      1080
     tacctgctcc tggacacccg cttcctgatc gaagacgtcg cgcaggacag ccagatcggc      1140
     gatgcggctc ccggtcgcaa gcagcaatgg aaagtggagg tcgacttcac cgcgcacccg      1200
     atggccgagc ccttgcgccc ggtgcccaca cgacccaagc cgctcacgca cggcccccag      1260
     accgcgcggg tggtcggccc tcctggccag aacatctgga ccgacaagtg gggccgcatc      1320
     aaggtgcagt ttccctggga ccgcatcgga aacgaggacc agcacagctc ctgctggata      1380
     cgcgtgaacc tgcacggcgc gggcaaccag cagggcagca tccatgtccc gcgcatcggc      1440
     caggaagtca tcgtcgactt tgtcggcggg gacccggacc tgccgatctg cacggggcgg      1500
     gtgtacaacc aggcgaacga gccgccgtgg gcattgcccc accacagtgc gctgtcgggc      1560
     tacaggagcc gggagctgac cgacaacggg ggcaacagct cggcggggcg cagcaaccac      1620
     atcgcgatgg acgacacgaa gggcaagatc caggtccaga tcaagagcga tcaccagcac      1680
     agccagctga gcctggggca catcacgcgc atcgaggaca acgcggggcg aaaagaccat      1740
     cgaggccaag gcttggaact gcgcaccgat ggtcatggcg ccattcgtgc cgcccagggt      1800
     ctgttgatca ccaccgaggg acgagccaac gccagggctc acatcacgga catggacgaa      1860
     acagcggcgc ggctgacagc ggcccacgag cagcacgaag ggttgtccgg cgctgcgcta      1920
     cagactgagg cgcattccac gggcgatcag gacgaagtta ttcaatcgat caaggcacag      1980
     aacgacgcga tcaagagcac cgccgccgca ggcaaagacc gcttccccga attagccgac      2040
     ccgcatctcg tattggcgag ccccgcaggc atcgaaacca ccacgtcgca gtcgacccat      2100
     attgccagcg ccgagcacaa cgcgctgacc agcggagggc acaccagcgt ctccgcagcc      2160
     aagagctttc tggtcagcgc caagcaggcg gttcgactct ttgcttacca agcagggctg      2220
     agactgttcg cattcggcgg caacatcgac atcaaggcgc tcaaggaaag catcaacatc      2280
     ctggccaagc tcgatatcgt ccaggtcgcc aacaggatca cgatcaccgc caaggaggaa      2340
     ctcgtgctca acggtggcgg aagcaccatt cgcctgaatg ctgcgggcat cgaagatgcc      2400
     acctctggaa agcatgtgga gcacgccgcc gtgcacagca tggtcgggcc gaagaacgca      2460
     ccgccccggt cggtgagcgg catgtcgagc ctggacctca agaaaaaagg ggcgctcagc      2520
     tttgtgctgc tttcgcacgc acaggacggc cggccgctcg gcttcgagcc ctacaccttg      2580
     tacagggacg gcgcgaatgt ggccgacggc gtcaccgacg ccgatgggca agtactcatt      2640
     gaagaccatc agagcgacac aacctcctac aaggtccggc tcgccaatgg caacgaatac      2700
     gaattgcccg tcaaggcaca gctgaaatcc aacgacgaca ggcttgcagc ctccggctat      2760
     cgcgcggctc acagcgacac gaagaaccgg atgcagcact acctgcggca ccgtgacgac      2820
     gaaggaaatt catga                                                       2835
//

If you have problems or comments...

PBIL Back to PBIL home page