(data stored in ACNUC1104 zone)

EMBL: CP002417.PE537

CP002417.PE537       Location/Qualifiers
FT   CDS_pept        586337..588475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0539"
FT                   /product="tetratricopeptide domain protein"
FT                   /note="KEGG: vap:Vapar_0502 tetratricopeptide domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34760"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0502"
FT                   /protein_id="ADU34760.1"
FT                   /translation="MAWFSRWGWERPARCRAGIAGALGLAGILLLGFGPPVSAQPNAEA
FT                   AASKAEQARLADTDTLLALTSEGAVLYGQDAVKLSGYQYCSQAVALAEAGEFRQSIRAA
FT                   SKALHLANATRDPNLMAMANRDLAIVYSYSGQLEKAEEFAREALKHPARDPKLVVGPVQ
FT                   KVIGDVRTRRGDFSGAVLSYDEALANSSPRYAPLVQASLVNALIESGDAVRAREVLGTM
FT                   PPPKDAPLTAQLDRTRARLLLAENKPAEARDMYRALTARQVGADTEYYRLWAWDGVARS
FT                   EIALGQKQAAAEAVGQALGGVDKVRAKFRSEEFKMGLFSDLQSVFERGVSVYSDAGDAR
FT                   AAFEVSEHSRSRALLDAVRGRAKVSEQASNTVDLATLQRTLAADERVVQFHSLPDRLVV
FT                   WVVSPSAIQEKTVAVKREELNELVETFRNSIVRGRRTAITNADKLGAALLGPLGLAPGQ
FT                   RLVIVPHGPLHYLPFQALRLDGRYIIETHPVSVAPSMSIAVQLAQRTPRVNASLTAFGN
FT                   PRIEDKYDLPGAETEVKQLAQLFPRNTVFMGAAATKTQFRDVAARSPLMHVAAHAEADA
FT                   VDPLYSRILLANEGGKQNFLEAHEILGMPMDGTALVTLSACESGLGRIAQGDEVLGFTR
FT                   SFLSAGSSSLIASLWPVSDDATAVLMGTLYGELSKGRDLQKAMQAGQLAVLKDPKMSHP
FT                   FFWAPFNLIGNWRLTVGS"
     atggcgtggt tttcaagatg gggatgggag cgccctgcac gttgtcgtgc gggaatcgca        60
     ggcgcgctcg gcctggccgg cattcttctg ctgggcttcg gccccccggt ctcggcgcag       120
     ccgaatgccg aagcggcagc cagcaaggcc gagcaggccc ggctcgccga caccgacacc       180
     ttgctggcac tgaccagcga aggcgccgtg ctctacgggc aggacgcggt caagctctcg       240
     ggctaccagt actgcagcca ggccgtcgca ttggcggagg cgggcgaatt ccgtcagagc       300
     atccgcgccg cgagcaaggc gctgcacctg gccaacgcca cgcgcgatcc gaacctcatg       360
     gcgatggcca atcgcgacct ggcgatcgtc tacagctact cgggccagct cgaaaaagcc       420
     gaggagttcg cacgcgaggc gctcaagcat ccggcgcgcg atccaaagct ggtggtcggc       480
     ccggtgcaga aggtgatcgg cgacgtgcgc acgcgccgcg gcgatttctc gggagcggtg       540
     ctcagctacg acgaagcgct cgccaacagc tcgccgcgct atgcgccgct ggtgcaggcc       600
     tcgctggtca acgcgctcat cgaatcgggt gatgccgtcc gggcgcgcga agtgctcggc       660
     accatgccgc cgcccaagga cgcaccgctc accgcgcagc tcgaccgcac gcgcgcccgc       720
     ctgctgctgg ccgagaacaa gccggccgag gcgcgcgaca tgtaccgcgc gctcaccgcg       780
     cggcaggtcg gggccgatac cgagtactac cgcctctggg cctgggacgg cgtggcgcgc       840
     agcgagatcg cgctgggcca gaaacaggcc gcggccgagg ccgtgggcca ggcgctgggc       900
     ggcgtggaca aggtgcgcgc caagttccgc agcgaagaat tcaagatggg cctgttctcc       960
     gacctgcagt cggtgttcga gcgcggcgtg tcggtgtaca gcgatgcggg cgatgcgcgc      1020
     gcggccttcg aggtcagcga gcacagccgc tcgcgtgcgc tgctcgacgc ggtacgcggg      1080
     cgcgcgaagg tcagcgagca ggcttccaac acggtcgacc tcgccacgct gcagcgcacg      1140
     ctggccgccg acgagcgcgt ggtgcagttc cactcgctgc ccgaccgcct cgtggtgtgg      1200
     gtcgtgagcc cgagcgcgat tcaagagaag acggtggccg tcaagcgcga ggagctcaac      1260
     gagctggtcg agaccttccg caactccatc gtgcgcggac gccgcaccgc cattaccaac      1320
     gccgacaagc tcggcgccgc gctgctcggg ccgctcggcc tcgcaccggg gcagcgcctc      1380
     gtcatcgtgc cgcacggccc gctgcactac ctgccgttcc aggcgctgcg gctggacggc      1440
     cgctacatca tcgagacgca cccggtgtcg gtcgcgccgt cgatgagcat cgcggtgcag      1500
     ctcgcgcagc gcacgccgcg cgtgaacgca tcgctcaccg ccttcggcaa tccgcgcatc      1560
     gaggacaagt acgacctgcc cggcgccgag accgaggtga agcaactcgc gcagctcttc      1620
     ccgcgcaaca ccgtgttcat gggcgcggcc gccaccaaga cgcagttccg cgacgtggcc      1680
     gcgcgctcgc cgctgatgca cgtggccgcg cacgccgagg ccgatgcggt cgatccgctg      1740
     tactcgcgca ttctcctggc caacgaaggc ggaaagcaga acttcctcga agcgcacgag      1800
     atcctgggca tgccgatgga cggcactgca ttggtcacgc tctcggcctg cgaatcgggg      1860
     ctcggtcgca tcgcgcaggg cgacgaggtg ctgggcttca cgcgttcgtt cctctcggcc      1920
     ggcagctcca gcctgatcgc ctcgctgtgg cccgtgtcgg acgacgcgac cgcggtactc      1980
     atgggcacgc tttacggcga actctccaag ggccgcgacc tgcagaaggc catgcaggcc      2040
     ggacaactcg ccgtgctgaa ggaccccaag atgtctcatc ccttcttctg ggcgccgttc      2100
     aacctgatcg gcaactggcg cctcaccgtc gggagctga                             2139
//

If you have problems or comments...

PBIL Back to PBIL home page