(data stored in ACNUC1104 zone)

EMBL: CP002417.PE538

CP002417.PE538       Location/Qualifiers
FT   CDS_pept        588479..590269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0540"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; KEGG: vap:Vapar_0503
FT                   polypeptide-transport-associated domain protein ShlB-type"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34761"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F5"
FT                   /inference="protein motif:PFAM:PF08479"
FT                   /protein_id="ADU34761.1"
FT                   /translation="MRNAMNSSNRSTALAPRSALRPIAWATGALVSAVLFMAADRAHAE
FT                   EHAQAEQQAAPANDAGDSTELLPTKDPCGTCDRPLAQATGTVAPQSLPAPPRPAGTTFK
FT                   LNDLRLNGVKALTNAELQSITAPYIGRDVTLGDLEGLAQAITARYKERGYFLAQAIVPV
FT                   QTVRDGIVEISVIEGRLGKVDVVVAPDAPLSEARVRGFLAPLQPGEAVSAQGYERAMLL
FT                   LSDQPGVKVSSGLQEGTSPGTTDLSVEVAAAPRWAFTAEADNHGTKESGRYRVGGTARW
FT                   LSPFGIGDNLDMRLMVSDSNDLQFGRIAYEAPIGTSGLRAGVGLARVNYELGGQFADYE
FT                   ARGRANVLDFSLNYPLIRQRQQNLFLRLGADIKDLTDEVGIANTTSRKRVHGLSMGWTW
FT                   ERRDEVLGGGYWASTGTLYHGNLSIRDPESRLADQSLGGHNTEGGFTKMTFQLSRLQAI
FT                   VPRHSLYLSVGGQWASKNLDGSEKLALGGARAVRAYPSGELLVDQGVIGTAEWRWSFNE
FT                   ELTPFLFYDAARGKIVRNPTVFDGANSHSLRGYGVGVSWSRPGNFSINATLAWRAGTPP
FT                   AQTDGGGRNPRLYVQLIKAF"
     atgcgcaacg ccatgaacag cagcaaccgc tccaccgccc tcgctccacg cagcgcactg        60
     cgccccatcg cctgggccac cggcgccctg gtgtcggccg tcctcttcat ggcggcggac       120
     cgcgcgcatg ccgaggaaca cgcgcaggct gagcaacaag ccgcaccggc caacgatgcc       180
     ggcgacagca cggaactgct cccgacaaag gacccgtgcg gcacctgcga ccgcccgctc       240
     gcgcaagcga ccggcaccgt cgcgccgcaa agcctgcccg caccgccgcg ccccgccggc       300
     acgacgttca agctcaacga tctgcgactg aacggcgtga aggcgctgac caacgcagag       360
     ctgcagtcga tcaccgcgcc ctacatcggc cgcgacgtca cgctgggcga tctcgaaggg       420
     ctcgcgcagg cgatcaccgc gcgctacaag gagcgcggct acttcctcgc gcaggccatc       480
     gtgccggtgc agacggtgcg cgacggcatc gtcgagatca gcgtgatcga agggcgcctg       540
     ggcaaggtcg acgtggtcgt cgcgcccgat gcgccgctca gcgaggcgcg cgtgcgcggc       600
     ttcctcgcgc cgctgcagcc gggcgaagcg gtcagcgcgc agggctacga gcgcgcgatg       660
     ctgctcttgt ccgaccaacc gggcgtgaag gtgtcgtcgg gcctgcagga aggcacgtcg       720
     cccggcacca ccgacctgtc ggtcgaagtg gccgccgcac cgcgctgggc cttcacggcc       780
     gaggccgaca accacggcac caaggaatcg gggcgctacc gcgtcggcgg caccgcgcgc       840
     tggctcagcc ccttcggcat cggcgacaac ctcgacatgc gcctgatggt gtccgacagc       900
     aacgacctgc agttcggccg catcgcgtac gaagcgccca tcggcaccag cgggctgcgt       960
     gcgggcgtgg gcctcgcgcg cgtcaactac gaactcggcg gccagttcgc ggactacgag      1020
     gcgcgcggcc gcgccaacgt gctggacttc tcgctcaact acccgctgat ccgccagcgc      1080
     cagcagaacc tgttcctgcg cctgggcgcc gacatcaagg acctgaccga cgaggtcggc      1140
     atcgccaaca ccacttcgcg caagcgcgtg cacggcctca gcatgggctg gacctgggag      1200
     cgccgcgacg aggtgctcgg cggcggctac tgggcgagca ccggcacgct ctatcacggc      1260
     aacctgtcga tccgcgatcc cgagagccgg ctggccgacc agagcctcgg cggccacaac      1320
     accgaaggcg gcttcaccaa gatgaccttc cagctctcgc ggctgcaggc catcgtgccg      1380
     cgccattcgc tgtacctctc ggtcggcggc cagtgggcga gcaagaacct cgacggctcc      1440
     gaaaagctcg cgctcggcgg cgcgcgcgcg gtgcgtgcgt atccctcggg cgaactgctg      1500
     gtggaccagg gcgtgatcgg cactgccgag tggcgctggt cgttcaacga agagctcacg      1560
     cccttcctgt tctacgacgc cgcacgcgga aagatcgtgc gcaaccccac ggtcttcgac      1620
     ggcgccaaca gccacagcct gcgcggctac ggcgtgggcg tgagctggtc gcggccgggc      1680
     aatttctcga tcaacgccac gctcgcctgg cgcgccggca cgccgccggc gcagaccgac      1740
     ggcggtgggc gcaatccgcg cctctacgtg cagctcatca aggcgttctg a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page