(data stored in ACNUC1104 zone)

EMBL: CP002417.PE54

CP002417.PE54        Location/Qualifiers
FT   CDS_pept        56723..57268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0054"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   vap:Vapar_0049 protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34277"
FT                   /db_xref="GOA:E6UXT3"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT3"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ADU34277.1"
FT                   /translation="MTVSRILLLPGWQNSGPGHWQTIWESIHGDRRVEQHDWMRPLRGD
FT                   WSARLEEEVLAAPGPVAFAAHSLGCILVAAWAAHSRNTHKVAGALLVAPGDVEREDLRQ
FT                   LIPGWAPIVRQPLPFSSVLIAANDDPYCEASRSRQLAKDWGARFIDAGKGGHLNAESGL
FT                   GDWPEGRQLLNDISKDKN"
     atgacagttt cccgcatcct gctgctgccg ggttggcaga acagcggccc cggccattgg        60
     cagaccattt gggagtcgat ccatggcgat cgccgtgtcg agcaacacga ctggatgcgc       120
     ccgctgcgcg gtgactggtc tgcgcgactt gaagaagaag tgctggcggc ccccgggccg       180
     gtggcctttg cggcgcacag cctcggctgc atcctcgtcg cggcctgggc cgcgcattcg       240
     cgcaacacgc acaaagtagc cggcgcattg ctggtggcgc ctggcgatgt ggagcgtgag       300
     gatcttcggc aactgattcc gggctgggcg ccgatcgtgc gccagccgct gcctttctcc       360
     tcggtgctga tcgccgcgaa cgacgaccct tactgcgaag cctcgcgctc gcggcaactg       420
     gccaaggact ggggcgcacg cttcatcgac gccggcaagg gcggccacct gaacgccgaa       480
     tccggcctgg gcgactggcc cgaaggccgg caacttctga acgacatttc gaaagacaag       540
     aactga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page