(data stored in ACNUC1104 zone)

EMBL: CP002417.PE540

CP002417.PE540       Location/Qualifiers
FT   CDS_pept        complement(596572..597450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0542"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   mgi:Mflv_5092 FkbM family methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34763"
FT                   /db_xref="GOA:E6V5F7"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F7"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ADU34763.1"
FT                   /translation="MNTMTQTTRAAVDLRDILAPRRLTEVVDVGANPIDGDPPYLAMLQ
FT                   AGLCRVTGFEPQLSALHELTQAQGPLERYLPWALGDGGMHTLHVCAAPGMTSLLAPDAQ
FT                   SLALFEALQPLAEVRERIAVQTRRLDDIAEIAHLDFLKIDVQGSELAVFRAGRAKLAQA
FT                   VMVQTEVSFVTLYKDQPTQGEIDQELRGQGFVPHCFAAVKQWPIAPCVVDGDPRRPLRQ
FT                   LLEADLVYMRDIRRPEAMDDEQLRHLALVAHHCHGSFDLALRCLLLLEERRAVEAGAQQ
FT                   RYLQLLAARGA"
     atgaacacga tgacgcagac cacacgcgct gccgtggacc tgcgcgacat ccttgcgccg        60
     cggcggctga ccgaggtggt cgatgtcggg gccaacccga tcgacggcga cccgccctat       120
     ctcgcgatgt tgcaggccgg gctgtgccga gtcacgggct tcgagccgca gctttcggcg       180
     ctgcatgaac tgacgcaggc ccagggtccg ctcgagcgct acctgccgtg ggcgctcggc       240
     gacggcggca tgcacacgct gcatgtctgc gccgcaccgg gcatgaccag cctcctcgcg       300
     cccgatgcgc aatcgctcgc gctcttcgag gccctgcagc cattggccga ggttcgcgaa       360
     cggatcgcgg ttcagacgcg gcggctcgac gacatcgccg agatcgcgca tctcgacttc       420
     ctgaagatcg acgtgcaggg cagcgagctc gcggtgttcc gcgcgggccg cgccaagctg       480
     gcgcaggccg tgatggtgca gaccgaggtg tccttcgtca cgctctacaa ggaccagccg       540
     acgcagggcg aaatcgacca ggagctgcgc ggccagggct tcgtgccgca ttgcttcgcc       600
     gcggtgaagc agtggccgat cgcgccgtgc gtggtggatg gcgatccgcg ccggcccctc       660
     cgccagctgt tggaggccga cctggtctac atgcgcgaca tccgccgccc cgaggcgatg       720
     gacgacgagc agctgcggca tctggccttg gtcgcacacc actgccacgg ctccttcgat       780
     ctcgcactgc gctgcctgct gctgctcgaa gagcgccgcg cggtcgaggc cggcgcgcag       840
     cagcgctacc tgcaactgct tgcggcgcgc ggtgcctga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page