(data stored in ACNUC1104 zone)

EMBL: CP002417.PE542

CP002417.PE542       Location/Qualifiers
FT   CDS_pept        complement(598343..598975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0544"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   vap:Vapar_0488 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34765"
FT                   /db_xref="GOA:E6V5F9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F9"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADU34765.1"
FT                   /translation="MSNTAAPRRVLVVIDVQNEYFEGGGLPIEYPPILDTLPNVTKAMD
FT                   AAHAAGVPVVVVRHHAPKGAPVFQADTHNGQLHPEVANRPRDHLITKTFPSVFTGTDFA
FT                   DWLALHEIDTLSVAGYMTQNCDASTVFEAMHRGLNVEFLADASGALPYANDAGKVTAEE
FT                   IHRVFSVVFHSNFAAVTSTAAWITAMQEGQAIAKDNVVMSNRRARGV"
     atgagcaaca ccgccgcccc ccgccgcgtc ctcgtcgtga tcgacgtgca gaacgaatac        60
     ttcgaaggcg gcggcctgcc gatcgagtac ccgcccatcc tggacacgct gcccaacgtg       120
     accaaggcga tggacgccgc acacgccgcc ggcgtgcccg tcgtcgtggt ccgccaccac       180
     gcccccaagg gcgcaccggt gttccaggcc gacacccaca atggccagtt gcaccccgag       240
     gtcgcgaacc gtccgcgcga tcacctcatc accaagacct tcccgagcgt gttcaccggc       300
     actgacttcg ccgactggct tgctctccac gaaatcgaca cgctgagcgt ggccggctac       360
     atgacgcaga actgcgatgc atcgacggtg ttcgaggcga tgcaccgcgg cctgaacgtg       420
     gagttcctcg ccgatgcgag cggcgcactg ccgtatgcaa acgacgcagg caaggtcaca       480
     gcggaagaga tccaccgcgt cttcagcgtc gtgttccaca gcaacttcgc ggccgtgact       540
     tcgactgcgg cgtggatcac cgcgatgcag gaaggccagg ccatcgcgaa ggacaacgtg       600
     gtcatgtcca accgccgcgc gcgcggcgtc tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page