(data stored in ACNUC1104 zone)

EMBL: CP002417.PE543

CP002417.PE543       Location/Qualifiers
FT   CDS_pept        599087..600073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0545"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: vap:Vapar_0489 transcriptional regulator, AraC
FT                   family; PFAM: ThiJ/PfpI domain-containing protein;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34766"
FT                   /db_xref="GOA:E6V5G0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G0"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADU34766.1"
FT                   /translation="MARTTTTTTETIAVVAFDGISPFHLSVPCMVFGEDRTEAGAPRFR
FT                   MRVCAPEPGPLRTNAGFDLVVPHGLEAIRRAQIVVVPSWRDDGRPAPPALIRALQAAHR
FT                   RGATVVGLCLGAFVLAEAGLLDGRPATTHWNLAAAFAKQYPKVSLQPEVLYVDDGDVLT
FT                   SAGTAAGIDCCLHLLRVRYGAETANRAARRMVVAPHRQGGQAQYIQQPMPATAERDRLA
FT                   PLLEWLGKHLDVPHELDELARRALMSRRTFTRRFRESTGTTVGQWIQNQRLALAQRLLE
FT                   TTDHPVERVATGAGFGSAVSLRKHFTSAFKVSPTVYRRQFSRTEEAA"
     atggcccgca caaccaccac gaccaccgaa accatcgcag tcgtcgcgtt cgacggcatc        60
     agcccctttc acctgtccgt gccctgcatg gtgttcggcg aagaccgcac cgaggccggc       120
     gcaccgcgct ttcgcatgcg cgtgtgcgcc ccggagccgg ggccgctgcg gaccaacgcg       180
     ggcttcgatc tcgtggtgcc gcatgggctg gaggcgatcc gccgggcgca gatcgtggtg       240
     gtgccctcgt ggcgcgacga tggacggccc gcaccgcctg cactcatccg cgcgctgcag       300
     gccgcgcacc ggcgcggcgc cacggtggtc ggcctctgcc tcggtgcctt cgtgctggcc       360
     gaggccgggc tgctcgacgg ccggcccgcc accacgcact ggaacctcgc cgccgcgttc       420
     gcgaagcagt acccgaaggt gagcctgcag cccgaggtgc tgtatgtcga cgacggcgac       480
     gtgctcacct ccgccggcac ggccgcgggc atcgactgct gcctgcatct cctgcgcgtg       540
     cgctacggcg ccgagacggc caaccgcgcg gcgcggcgca tggtggtcgc gccgcaccgg       600
     cagggtgggc aggcgcagta catccagcag cccatgcccg cgacggccga gcgcgaccgg       660
     ctcgcaccgt tgctcgaatg gctgggcaag cacctcgatg tgccgcacga actcgacgag       720
     ctcgcgcgcc gcgcgttgat gagccgccgc accttcacgc ggcgcttccg cgaatcgacg       780
     ggcacgacag tcgggcagtg gatccagaac cagcgcctcg cgttggcgca acggttgctg       840
     gagaccacgg accatccggt cgagcgcgtg gccaccggcg cgggcttcgg ctccgcggtg       900
     tcgctgcgca agcacttcac ctcggcgttc aaggtgtcgc cgacggtgta tcgcaggcag       960
     ttctcgcgga ccgaagaagc ggcttga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page