(data stored in ACNUC1104 zone)

EMBL: CP002417.PE544

CP002417.PE544       Location/Qualifiers
FT   CDS_pept        complement(600235..602190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0546"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="KEGG: vap:Vapar_0508 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; response regulator receiver; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34767"
FT                   /db_xref="GOA:E6V5G1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34767.1"
FT                   /translation="MNAPPPPQGPVPAGDDAVQPRAASALVVRGNLQGDLFRLGVVPCA
FT                   AVALALTGWFTHNRLQTLEAQFDAEGEAVARQVAAMSDLSLYAGDVPALQNVANAALRG
FT                   GQVMRVEISNSAGVYVTAGPKNESLAQLRMFTSPVTLREASRASAFAPAGSTAAGDTPI
FT                   GLVQTFRDTTAYARERSRSLMAGIGIALVALLAAWASVRHMARTVARPLRRVSRTVAAL
FT                   EAGHFDMRCEVVEGGTRGSHELAVLAHDIDRLAERLQHNRQVSEERVREATAVALQRMA
FT                   EAEQAALSRARFLAAASHDLRQPLHAMGLFIDGLLPTASAAQRPAVLRLQESTEFMGVL
FT                   LDDLLEISRLDAQVLTPTITRISLAALFDQLDAQHAAAAIEARVRLRWSDRGLAVRTDA
FT                   AMLQRIVNNLVANALRHAPEGGTVLVAARRIASGVRIEVRDNGVGIAPIHQGRIFEEFY
FT                   QVANTERDRRRGFGLGLAICARIATLLGTRITVRSALQAGSTFAFTLPAARAADVVLPE
FT                   PAPVAPAPLAGLRCLVVDDDPAILDGSRALLEQWGCEVECVATGAEAIARMGTGDIHFD
FT                   AVLCDLQLAGDGDGVDVIEAAKRLQPDALAVLVSGATGPEVLQRLRHGGVMLLTKPVPP
FT                   AKLRALLTTRRHAHAA"
     atgaacgccc cgccgccccc gcaaggtccg gtgcccgccg gcgacgacgc ggtgcagccc        60
     cgtgccgcgt ccgcgctggt cgtgcgcggc aatctgcagg gcgacctgtt ccgcctgggc       120
     gtggtgccgt gcgcggcggt ggcgctcgcg ctcaccggct ggttcaccca caaccggctg       180
     cagacgctcg aagcccagtt cgatgccgaa ggcgaggccg tggcgcgcca agtggcggcc       240
     atgtccgacc tgagcctgta cgcgggcgac gtgccggcgc tgcagaacgt ggccaatgcg       300
     gcgctgcgcg gcggacaggt gatgcgggtg gagatcagca acagcgcggg cgtgtacgtc       360
     acggccgggc ccaagaacga atcgctcgcg caattgcgca tgttcacctc gccggtcacg       420
     ctgcgcgagg cctcgcgcgc cagcgccttc gcgcccgcgg gctccaccgc ggcgggcgac       480
     acgcccatcg gcctggtcca gaccttccgg gacaccaccg cctatgcgcg cgagcgcagc       540
     cgctcgctca tggcgggcat cggcatcgcg ctggtggcgc tgctggcggc gtgggcctcg       600
     gtgcgccaca tggcgcgcac ggtggcgcgg ccgctgcggc gcgtgtcgcg caccgtcgcc       660
     gcgctcgaag ccggccactt cgacatgcgc tgcgaagtgg tcgagggcgg cacccgcggc       720
     tcgcacgaac tggcggtgct cgcgcacgac atcgaccggc tcgccgaacg cctgcagcac       780
     aaccgccagg tgagcgagga gcgggtgcgt gaagccaccg ccgtcgcgct gcagcgcatg       840
     gccgaagccg agcaggcggc gctttcgcgt gcgcgttttc tcgcggccgc gagccacgac       900
     ctgcgccagc cgctgcatgc gatgggcctc ttcatcgacg gcctgctgcc caccgccagc       960
     gcggcgcagc gcccggccgt gctgcggctg caggagagca ccgagttcat gggcgtgctg      1020
     ctggacgacc tgctggaaat ctcgcggctc gatgcgcagg tgctcacgcc caccatcacg      1080
     cgcatctcgc tggccgccct cttcgaccaa ctcgatgcgc aacacgccgc cgccgccatc      1140
     gaggcgcgcg tgcggctgcg ctggagcgac cggggcctgg cggtgcgcac cgacgcggcg      1200
     atgctgcagc gcatcgtcaa caacctcgtg gccaatgcgc tgcgccatgc gcccgaaggc      1260
     ggcaccgtgc tggtggccgc gcggcgcatc gcgtccggcg ttcgcattga agtgcgtgac      1320
     aacggcgtgg gcatcgcacc gatccaccag ggtcggatct tcgaggagtt ctaccaggtg      1380
     gcgaacaccg agcgcgaccg ccgccgcggc ttcggcctgg ggctcgcgat ttgcgcgcgc      1440
     atcgccacgc tgctgggcac ccgcatcacc gtgcgctcgg cgctgcaggc cggcagcacc      1500
     ttcgccttca ccctgcccgc cgcgcgcgcc gccgacgtcg tgctgcccga gcccgcaccc      1560
     gtcgcacccg cgccgctcgc gggcctgcgc tgcctggtgg tggacgacga ccccgccatc      1620
     ctcgacggca gccgcgcgct gctggagcag tggggctgcg aggtcgaatg cgtggccacc      1680
     ggcgccgagg ccatcgcgcg gatgggcacg ggcgacatcc atttcgatgc ggtgctgtgc      1740
     gatctgcaac tggccggcga cggcgacggt gtcgacgtga tcgaagcggc caagcgcctg      1800
     cagcccgacg cgctcgcggt gctggtgtcg ggcgcgacag ggcccgaggt gctgcagcgg      1860
     ctgcggcatg gcggcgtgat gctgctgacc aagccggtgc cgccggccaa gttgcgcgcg      1920
     ctgctcacta cgcggcggca cgcacacgcg gcctga                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page