(data stored in SCRATCH zone)

EMBL: CP002417.PE548

CP002417.PE548       Location/Qualifiers
FT   CDS_pept        606583..607608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0550"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: vap:Vapar_0513
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34771"
FT                   /db_xref="GOA:E6V5G5"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G5"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADU34771.1"
FT                   /translation="MPPALKHLLAAAFIAASGLLPPSLALAQAVNEKPVQTIRFGVLPL
FT                   GGTVESRALWTPFMADMSRSLGIPVNAYSVPSYEELDRAIGKDEIDMAFLSAKMALDAV
FT                   MQRRMKVVAQIARRPGMPEHRAVLLARKAGPLNTLEGMLAQPERWRLARGDSRSVTGFV
FT                   VPQSQLFLPNNIEMETRFLSEFVGTHQATALAVANGDADVATNNTTDLERFRQQFPIEA
FT                   ERLQVIWESTPPPGAPMVVRRNYPPEFQAKLQNFLITYGQGKGPHADGEREVLKNLRAA
FT                   YGYVAADDSALLPEARLEYELGKQRAMAAAWVNEAARAQRLQRIEKAYAEQVQTLRAGG
FT                   R"
     atgccccccg cactcaagca cctgctggca gccgccttca ttgcagcctc cgggctgctt        60
     ccgccgtcgc tcgccctggc gcaagcagtg aacgagaagc cggtccagac gatccgtttc       120
     ggcgtgctcc cgctcggcgg caccgtcgaa tcgcgcgccc tgtggacgcc cttcatggcc       180
     gacatgagcc gctccctcgg cattccggtc aatgcgtact cggtgccgtc gtacgaggaa       240
     ctcgaccgcg ccatcggcaa ggacgagatc gacatggcct ttctctccgc caagatggcg       300
     ctggacgccg tgatgcagcg ccgcatgaag gtcgtggccc agatcgcgcg ccgccccggc       360
     atgcccgagc accgcgcggt gctgctcgcg cgcaaggccg gcccgctcaa caccctggaa       420
     ggcatgctcg cccagcccga gcgctggcgc ctcgcgcgcg gcgacagccg ttcggtcacc       480
     ggcttcgtcg tgccgcagag ccaactcttc ctgccgaaca acatcgagat ggaaacccgc       540
     tttctcagcg agttcgtcgg cacccaccag gccaccgcgc tcgccgtggc caacggcgac       600
     gccgacgtgg ccaccaacaa caccaccgac ctcgagcgct tccgccagca gttccccatc       660
     gaggccgaac gactccaggt gatctgggag tccacgccgc cgcccggtgc gccgatggtg       720
     gtgcggcgca actacccgcc cgagttccag gcgaagctgc agaacttcct aatcacctac       780
     gggcagggca agggcccgca cgccgatggc gagcgcgaag tgctcaagaa cctgcgcgcg       840
     gcctacggct atgtcgcggc cgacgacagc gcgctgttgc ccgaggcgcg gctggaatac       900
     gaactcggca agcagcgcgc catggccgcc gcctgggtga acgaagcggc gcgcgcccag       960
     cggctgcagc gcatcgagaa ggcgtatgcg gagcaggtgc agacgctgcg tgccggcggg      1020
     cgctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page