(data stored in ACNUC1104 zone)

EMBL: CP002417.PE55

CP002417.PE55        Location/Qualifiers
FT   CDS_pept        57268..58209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0055"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: vap:Vapar_0050 ParB-like
FT                   partition protein; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34278"
FT                   /db_xref="GOA:E6UXT4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT4"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ADU34278.1"
FT                   /translation="MATKKPKGLGRGLEALLGPTAAPAADHGNSGTEEGAAPPNPTTLM
FT                   LDQMVAGVYQPRTRMDEGALYELAESIKVQGIMQPILVRRLDAESAAAKNAEYEIIAGE
FT                   RRFRAAKLAGLESVPVLVRDVPNEAAAAMSLIENIQREDLNPLEEAQGLQRLVAEFGLT
FT                   HEMAAQAVGRSRSAASNLLRLLNLAEPAQQMLMAGDIDMGHARALLSLDRGTQITAANQ
FT                   IAAKKMSVRETEALVKKLAAEFTLTPSRRGNSGEKSRDLQRVEEELADLLTAEVEVRIK
FT                   KRTKRGESGELAIHFGSIEALNGLIERIRRTA"
     atggcgacca agaaacccaa gggcctcggc cgcggcctcg aagcgctgct cggcccgacg        60
     gccgcacccg ccgccgacca cggcaactcg ggaacggaag agggcgccgc gccgccgaac       120
     ccgaccacgc tgatgctcga ccagatggtg gccggcgtct accagccgcg cacgcgcatg       180
     gacgaaggcg cgctctacga gttggccgag agcatcaagg tgcagggcat catgcagccg       240
     atcctggtgc gccggctcga tgccgaatcg gcggccgcca agaacgccga gtacgaaatc       300
     atcgcgggcg aacggcgctt ccgagccgcc aagctggcgg gcctggagag cgtgccggtg       360
     ctggtgcgcg acgtgcccaa cgaggccgca gcggcgatgt cgctgatcga gaacatccag       420
     cgtgaagacc tcaacccgct cgaagaggct caaggcctgc aacgcctggt cgccgagttt       480
     gggctcactc acgaaatggc ggcgcaggcc gtgggccgct cgcgcagcgc ggccagcaac       540
     ctgttgcgcc tcttgaacct ggccgaaccc gcgcagcaga tgctgatggc cggagacatc       600
     gacatgggcc acgcccgcgc gctgctctcc ttggaccgcg gcacgcagat cacggccgcc       660
     aaccagattg ccgccaagaa gatgtcggtg cgcgagaccg aggcgctggt gaagaagctc       720
     gccgccgagt tcaccttgac gccgtcccgc cgcggcaaca gcggcgagaa gtcgcgcgat       780
     ctgcagcgag tggaagaaga gctggccgac ctgctcaccg ccgaggtcga ggtgcgcatc       840
     aagaagcgca cgaagcgcgg cgaaagcggc gagctcgcga tccatttcgg ctccatcgaa       900
     gcgctgaacg gattgatcga acgcatccgc cgaacggcct ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page