(data stored in SCRATCH zone)

EMBL: CP002417.PE551

CP002417.PE551       Location/Qualifiers
FT   CDS_pept        610673..614272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0553"
FT                   /product="type VI secretion protein IcmF"
FT                   /note="KEGG: vap:Vapar_0516 type VI secretion protein IcmF;
FT                   TIGRFAM: type VI secretion protein IcmF; PFAM: ImcF domain
FT                   protein; protein of unknown function DUF1215"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34774"
FT                   /db_xref="GOA:E6V5G8"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G8"
FT                   /inference="protein motif:TFAM:TIGR03348"
FT                   /protein_id="ADU34774.1"
FT                   /translation="MIKKIFGFLFSPLLLTLLALIVVGLLIWWIGPLVKIGSLAPLESE
FT                   LARWLLIGAIVLIVVLRMAWRRWRARRASQHLTDGLMKAPTVKTDAPANGEQKILDTRF
FT                   SEAVATLKQMRLHAAGKKPGWRDWMSISGGSYLYDLPWYVFIGAPGAGKTTALVNSGLS
FT                   FPLAEKFGPGAIRGVGGTRNCDWWFTDEAVLIDTAGRYTTQDSHQTEDKNAWEGFLGLL
FT                   KKARPRRPLNGVFLTVSVADLLSQGPEQRTQLAASIRARLLELDSKLTTRLPVYVLVTK
FT                   SDLLYGFTDYFDDLGKEQRAQVFGFTLPADENVQTEEKGLSTAFHREFALLHNRVNDGL
FT                   IPRMQRETDGGRRAAIFGFPAQFGSIGSLLSDLLDQVFTGSRFAQPPWVRGVYFTSGTQ
FT                   EGSPIDRVMGSLSRSFGIERAMLAPQKSSGRSYFLTSLLRDVVFPEQRLAGADVKLERR
FT                   RHLLRMTGVAAMTLVTVGLIAGWGYSTWQNTNYLKSVEARAVPAQKSLANLPVQLQNLV
FT                   EVAPVMQGIRDIWKTPENRQGDEPLSMTLGLYQGNKLDAAARLAHQRALNDVFLPQIAK
FT                   RIEDQLRTAQKDNLEYTYEALKSYLMLYQPEHFDPEALKAWITLDWARSLDRGIPEEQR
FT                   MALEEQLDVLIAQGPPRSPLKMDENLVRSVRAVLASYPLEQRVFSRLKRQRATKDIPGF
FT                   SVATAAGPSAPLVFERISGKPLTEGVPGMFTYDGYHKRFQNEVTVLTGLLAAEDPWVLG
FT                   QDKGAADRLRDVAALGALTDRVRRLYLAEYVKQWEALLGDVRLIRATGLDKNIEAARIL
FT                   SGVSSPLANFLRAVVKETTLIPADQPKDVVSKATATVASTRKGLEDLFGGDPNKPVATG
FT                   KRIESIVDDRFEPLRRLVTAAAPGQPAPIDDALKLFNEVYVYLNAVDTAVKGRTSPPPG
FT                   DVAGKLKADAGRLPEPVRSMVENLSQSGAAQAQVAERGNLSQDLRPVTEFCARAIAGRY
FT                   PFSPTSKRDVLPEDFGQMFGAGGLMDDFFQKRLAALVDTSTRPWRYKPVAERGAITTQA
FT                   LAQFERAARIKDIFFRAGGRGPSMRLDFKPVEMDAGITQFILDVDGQLVKYAHGPVVPM
FT                   AVQWPGPKGSNQVRIQVSPPSTTGSSGSAVDGPWALFRALDDGQLEAGDAPEKFFITFQ
FT                   IGARKTRFEVTTNSVQHPIRLRELREFSCPEGL"
     atgatcaaga aaatcttcgg cttcctgttc agtccgctgc tgctgacgct gctcgcgctc        60
     atcgtcgtcg ggctcctgat ctggtggatc ggaccgctgg tgaagatcgg ttcgctcgcc       120
     ccgctcgaaa gcgagttggc gcgctggctg ctgatcggcg ccatcgtgct catcgtcgtg       180
     ctgcgcatgg cgtggcggcg ctggcgcgcg cgccgtgcga gccagcacct gaccgatggc       240
     ctcatgaaag cgccgacggt gaagaccgac gcaccggcca atggcgagca gaagattctc       300
     gatacgcgct tcagcgaagc cgtcgccacc ttgaagcaga tgcgcctgca cgccgccggc       360
     aagaagccgg gctggcgcga ctggatgtcc atctcgggcg gcagctatct gtatgacctg       420
     ccttggtacg tcttcatcgg cgcgcccggt gctggcaaga cgacggcact cgtgaactcg       480
     ggcctgtcgt tcccgctcgc cgagaagttc ggccccggcg cgatccgcgg tgtgggcggc       540
     acgcgcaact gcgactggtg gttcaccgac gaggcggtgc tcatcgacac cgccggccgc       600
     tacaccacgc aggacagcca ccagaccgag gacaagaacg catgggaagg cttcctcggc       660
     ctgctcaaga aagcgcgccc gcgccgtccg ctgaacggcg tgttcctcac ggtgagcgtc       720
     gccgacttgt tgagccaagg gcccgagcag cgcacgcaac tcgccgcatc gatccgcgcg       780
     cgtttgctcg aactcgacag caagctcacg acccgcctgc cggtgtatgt gctcgtcacc       840
     aagagcgacc tgctctacgg cttcaccgat tacttcgacg acctcggcaa ggagcagcgc       900
     gcgcaggtct tcggcttcac gctgccggcc gacgagaacg tgcagaccga agagaagggc       960
     ctctccaccg ccttccatcg cgagttcgcg ctgctgcaca accgcgtgaa cgacggcctc      1020
     attccgcgca tgcagcgcga gaccgacggt gggcgccgcg cggcgatctt cggtttcccg      1080
     gcgcagttcg gctccatcgg ctcgctgctg tcggacctgc tcgaccaggt gttcaccggc      1140
     tcgcgcttcg cgcagccgcc gtgggtgcga ggcgtgtact tcaccagcgg cacgcaggag      1200
     ggcagcccga tcgaccgcgt gatgggcagc ctgtcgcgca gcttcggcat cgagcgcgcg      1260
     atgctcgcgc cgcagaagtc gagcggccgc agctacttcc tcacatcgct gctgcgcgac      1320
     gtggtgtttc ccgagcagcg cctcgcaggc gccgacgtga agctggagcg ccgccgccat      1380
     ctgctgcgca tgacgggcgt ggccgcgatg acgctggtca cggtcggcct catcgcgggc      1440
     tggggctaca gcacctggca gaacacgaac tacctgaagt cggtggaagc gcgcgccgtg      1500
     cccgcgcaga agagcctggc caatcttccg gtgcaactgc agaacctggt cgaggtcgcg      1560
     cccgtgatgc agggcatacg cgacatctgg aagacacccg agaaccgcca gggcgatgag      1620
     ccgctcagca tgacgctggg cctctaccag ggcaacaagc tcgacgccgc cgcgcgcctt      1680
     gcgcaccagc gcgcgctcaa cgacgtgttc ctgccgcaga tcgccaagcg catcgaggac      1740
     cagctgcgca ccgcgcagaa ggacaacctg gagtacacgt acgaagcgct caagagctat      1800
     ttgatgctct accagcccga gcacttcgac cccgaggcgc tgaaggcctg gatcacgctc      1860
     gactgggcgc gcagcctgga ccgcggcatt cccgaagagc agcgcatggc gctcgaagag      1920
     cagctcgacg tgctcatcgc ccaaggcccg ccgcgctcgc cgctcaagat ggacgagaac      1980
     ctcgtgcgca gcgtgcgcgc cgtgctcgcg agctatccgc tggaacagcg cgtgttcagc      2040
     cgcctgaagc gccagcgcgc gaccaaggac attccgggct tcagcgtggc gacggccgcc      2100
     ggcccctcgg cgccgctcgt gttcgagcgc atcagcggca agccgctgac cgaaggcgtg      2160
     ccgggcatgt tcacctacga cggctatcac aagcgcttcc agaacgaagt gacggtgctc      2220
     accggcctgc tcgccgccga agacccgtgg gtgctcggac aggacaaggg cgccgccgac      2280
     cgcctgcgcg acgtggccgc gctcggcgcg ctgaccgacc gcgtgcgccg cctgtacctc      2340
     gccgagtacg tgaagcaatg ggaagcgctg ctcggcgatg tgcggctgat tcgcgccacg      2400
     ggtctcgaca agaacatcga ggccgcgcgc attctctcgg gcgtgagctc gccgctcgcg      2460
     aacttcctgc gcgccgtggt gaaggagacc acgctgatcc ccgccgatca accgaaggac      2520
     gtggtgagca aggccaccgc caccgtcgcc agcacccgca agggcctgga agacctgttc      2580
     ggcggcgacc ccaacaagcc ggtcgcgacc ggcaagcgca tcgagagcat cgtggacgac      2640
     cgcttcgagc cgctgcgccg cctggtcacc gccgcggcgc ccggccagcc cgcgccgatc      2700
     gacgatgcat tgaagctctt caacgaggtg tacgtgtacc tcaacgcggt cgacacggca      2760
     gtgaagggcc gcacctcgcc gccgcccggc gatgtggccg gcaagctcaa ggccgatgcc      2820
     ggccggctgc ccgagccggt gcgctcgatg gtcgagaacc tgagccagtc gggcgccgcg      2880
     caggcgcagg tggccgagcg cggcaacctg agccaggacc tgcgccccgt gaccgagttc      2940
     tgcgcgcgtg ccatcgcggg ccgctatccg ttctcgccca ccagcaagcg cgatgtgctg      3000
     cccgaggact tcggccagat gttcggcgcc ggtggcctga tggacgactt cttccagaag      3060
     cggctggctg cattggtcga tacgagcacg cggccgtggc gctacaagcc cgtggccgag      3120
     cgcggcgcga tcaccacgca ggcgctcgcg cagttcgagc gtgccgcgcg catcaaggac      3180
     atcttcttcc gcgcgggtgg ccgcgggcct tcgatgcggc tggatttcaa gccggtggag      3240
     atggatgcgg gcatcacgca gttcatcctc gatgtcgatg ggcagctcgt gaagtacgcg      3300
     catggccccg tggtgccgat ggcggtgcag tggccggggc cgaagggcag caaccaggtg      3360
     cgcatccagg tgagtccgcc ttcgacgacc ggcagttcgg gctcggcggt cgatgggccg      3420
     tgggcgctgt tccgtgcgct ggacgatgga cagctcgaag ccggtgatgc gccggagaag      3480
     ttcttcatca ccttccagat cggcgcgcgc aagacgcgtt tcgaggtgac gacgaacagc      3540
     gtgcagcatc cgattcgctt gcgtgagctg cgggagtttt cttgtccgga ggggttgtga      3600
//

If you have problems or comments...

PBIL Back to PBIL home page