(data stored in ACNUC1104 zone)

EMBL: CP002417.PE553

CP002417.PE553       Location/Qualifiers
FT   CDS_pept        614910..615749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34776"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0184"
FT                   /protein_id="ADU34776.1"
FT                   /translation="MNSLLPFTFRGRVSPRQATYFSLLRQRKVGKRKATLLSATLRFAA
FT                   GNLRCSRFAGSRRTRFAQTAASPDPRTAALLGAARRALGTDRPSLRSASSRAFAALGRG
FT                   APAPALPREGREKDKTCDTGPDALLLPLPGEGWDGGTTALAAQLRLIERRVPPPQPSPG
FT                   RGGSQSKPSEAMARDVFKAERSDGASESPSVCAEERSVSRIRARPCLSEASLGETPRNV
FT                   STAGCPKRSAGTQTAGSPFLCLRSFGEAKESKSPAGARPGLRPSQGKQSIQPAGASR"
     atgaactcct tgcttccttt tactttccga ggccgggtct cgccccggca ggcgacctac        60
     ttttctttgc ttcgccaaag aaaggtaggc aaaagaaagg cgaccctgct gtctgcgacc       120
     ctccgcttcg ctgcgggcaa cctgcggtgc tcgcggttcg cggggtctcg cagaactcgc       180
     ttcgctcaaa cagctgcgag ccctgatccg cgaaccgctg cgctcctcgg cgcagccaga       240
     agggctttgg ggaccgacag gccatcgctg cgctcggcca gttcacgggc cttcgctgcg       300
     ctcggccgtg gtgcccccgc cccggccctc ccccgggagg ggagggagaa agacaagaca       360
     tgcgacaccg ggcctgatgc attgctcctt ccccttccgg gggaaggctg ggatgggggc       420
     acgacggccc tcgctgcaca gctgcgcctc atcgagcgcc gcgtgccccc accccaaccc       480
     tcccccggaa ggggagggag ccaatccaag ccgagcgaag cgatggctcg ggatgtcttc       540
     aaagccgagc gtagcgatgg cgcgtccgaa agcccttctg tatgcgccga ggagcgcagc       600
     gtttcgcgga tcagggctcg cccttgtttg agcgaagcga gtttgggcga gaccccgcga       660
     aacgtgagca ccgcaggttg cccgaagcga agcgcaggga cgcagacagc agggtcgcct       720
     tttctttgct tacgttcttt tggcgaagca aaagaaagta agtcgcccgc cggggcgaga       780
     cccggcctcc gcccctcgca ggggaagcaa agcatccaac cagcaggagc aagtcgatga       840
//

If you have problems or comments...

PBIL Back to PBIL home page