(data stored in ACNUC1104 zone)

EMBL: CP002417.PE554

CP002417.PE554       Location/Qualifiers
FT   CDS_pept        615746..617689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0556"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: vap:Vapar_0519 serine/threonine protein
FT                   kinase; PFAM: Serine/threonine-protein kinase-like domain;
FT                   SMART: serine/threonine protein kinase; Tyrosine-protein
FT                   kinase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34777"
FT                   /db_xref="GOA:E6V5H1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADU34777.1"
FT                   /translation="MTDSPSNSSPPEDDRTRVVSRPAPQQQTTGTGDTAATVISAGVTS
FT                   LSNVPVTSPASATHEAGLLPVGSRLAEFEITRVIGQGGFGVVYEAWDHDLERVVAIKEY
FT                   LPTSLSTRQNDGTVVPLSERHRETFDLGMRSFINEARLLAQFDHPSLLKVYRFWQERGT
FT                   TYMVMPFYRGDTLREALVAIPAGVDESWLIRIMDGVTQALGVMHNANCYHRDIAPDNII
FT                   LLEGSGRPVVLDFGAARRVITDKTQAITVILKPGYAPIEQYAEMPDMSQGAWTDVYALA
FT                   AVMHVAVCGRAPPPSVARLLSDSYVPLAGNDILRQRYSLKLLQAIDAGLGVRPEQRPQS
FT                   MADLRAALDLEVGHSIAPTPRTQPPSGARTGGGNNNTGSNANAATVIAGKKAPPPPAPA
FT                   PGSGNSGAGKGKAVAAIASIAVVAAVAGGGWWWYQGRAGGTDKQDVAIATPPPPLENVT
FT                   KLDPPPPPPPPPPPPPPAAPRTPLESLQSLAAGAAPGFEVTATAKKPEVAIGKDKLAFE
FT                   VRSKRDGFVYVFLLSSGGEMFLLFPNLLDKYNKINANSALALPRASWPMDAGGPAGTNQ
FT                   FAVLVSEHERDFSASGVQNDGVFPQFPLPVLSALEATRGTGPSPLLGKPTCAPGAPCND
FT                   VYGVANFKIVEK"
     atgaccgact ctccctccaa ctcctcgccg ccggaagacg accgcacaag ggtcgtctcc        60
     cgccccgcac cgcagcagca gacaacaggc accggcgaca ccgccgcaac cgtaatcagc       120
     gccggcgtga caagcctctc caacgtcccg gtcaccagcc ccgcatcagc aacgcatgaa       180
     gcaggcctcc tccccgtagg cagccgccta gcagaattcg aaatcacccg agtcataggc       240
     caaggcggct tcggcgtcgt ctacgaagcc tgggaccacg acctcgaacg cgtcgtcgcc       300
     atcaaggagt acctgccaac ctctctctcg acaaggcaga acgacggcac cgtcgtcccc       360
     ctctccgaga gacacagaga aacattcgac ctcggcatgc gcagcttcat caacgaagcc       420
     cgcctcctcg cccagttcga ccacccgtca ctgctgaagg tctacaggtt ctggcaagag       480
     cgcggcacca cctacatggt gatgcccttc taccgaggcg acacgctgag agaagcactg       540
     gtcgccatcc ccgcgggcgt cgacgagtcc tggctcatcc gcatcatgga cggcgtcacg       600
     caggcgctcg gcgtgatgca caacgccaac tgctaccacc gcgacatcgc gcccgacaac       660
     atcatcctgc tcgaaggctc gggccgtccg gtggtgctcg acttcggcgc cgcgcgccgc       720
     gtgatcaccg acaagacgca ggcgatcacc gtcatcctca agcccggcta cgcgcccatc       780
     gagcagtacg ctgagatgcc cgacatgtcg caaggcgcgt ggaccgacgt ctacgcgctc       840
     gcggccgtga tgcacgtggc cgtgtgcggc cgcgcgccgc cgccttcggt ggcgcggctc       900
     ctgtccgaca gctacgtgcc gctcgcgggc aacgacatcc ttcgccagcg ctacagcttg       960
     aagctgctgc aggcgatcga tgcgggcctg ggcgtgcggc ccgagcagcg gccgcagtcg      1020
     atggctgacc tgcgcgcggc gctcgacctg gaagtcggcc acagcatcgc gccgacgccg      1080
     cgcacgcagc cgccttcggg cgcgcgcacc ggtggcggga acaacaacac gggctcgaac      1140
     gcgaacgccg ccacggtgat cgccggcaag aaggcgccac cgccaccggc gcccgcaccc      1200
     ggcagcggca acagcggcgc gggcaagggc aaggccgttg ccgccatcgc ctcgatcgcc      1260
     gtcgttgccg ccgtcgcggg cggaggctgg tggtggtacc agggccgcgc gggcggaacc      1320
     gacaagcagg acgtcgccat cgccacgccg ccaccgccgc tggagaacgt cacgaagctg      1380
     gaccctccgc cgcctccacc tccacctccg ccaccgcctc ctccggcagc accgcgcacg      1440
     ccgctcgaat cgctgcagtc gctcgcggcc ggcgccgcgc cgggcttcga ggtcacggcc      1500
     acggcgaaga agcccgaggt cgccatcggc aaggacaagc tcgccttcga ggtccgcagc      1560
     aagcgcgacg gcttcgtcta cgtgttcctc ctgtccagcg gcggcgagat gttcctcttg      1620
     ttcccgaacc tgctggacaa gtacaacaag atcaacgcca acagcgcgct cgcgctgccg      1680
     cgcgcctcat ggccgatgga cgccggcggc cccgccggca ccaaccagtt cgcggtgctc      1740
     gtcagcgaac acgagcgcga cttcagtgct tccggcgtgc agaacgacgg cgtgtttccg      1800
     cagttcccgc tgccggtgct ctcggcgctc gaagccacgc gcggcaccgg cccgtcgccg      1860
     ctgctgggca agccgacctg cgcgcccggc gccccgtgca acgacgtcta tggcgtcgcg      1920
     aatttcaaaa tcgtcgagaa gtaa                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page