(data stored in ACNUC1104 zone)

EMBL: CP002417.PE555

CP002417.PE555       Location/Qualifiers
FT   CDS_pept        617750..619342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0557"
FT                   /product="3D domain-containing protein"
FT                   /note="PFAM: 3D domain-containing protein; MltA domain
FT                   protein; KEGG: vap:Vapar_0520 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34778"
FT                   /db_xref="GOA:E6V5H2"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H2"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADU34778.1"
FT                   /translation="MHTSSQSPRFTGSTLIRWAAFAAVASLAGCVNPPPAATTADTTAA
FT                   TDTSSTTSSRPASTGASVAGQARTFSTQLATYTAVSFDAMPGWSRDDFSETWPAFLGSC
FT                   KVLTGRGAEWKEVCDRAGKVDGKNRNAIRGFFESEFSAYQIRDDDRKPDGVVTGYFEPE
FT                   IAGSRTYGAPFIYPVYGQPEDMLFADARKLPAGSGTVAAKVEGRNVVVQTGLSTRDMGA
FT                   PGLYALDLSAITRDTLDRKVRMRIEGKQLLPYYTREEIETKGAPNAKVLAFVSSATALY
FT                   EMQIQGSGRIKLANGDTIRVAYAEQNGQPFRPTIAQAANGKPRSAVKVRGSSIELQLDD
FT                   GDDDDVGSVDSSVIRTRGFTLARPTASGAVVVPGRRTAGAVAGSGIKDPSYVFFKEATS
FT                   PAGGPVGAFGVPLSAGRSIAVDPRSTPLGYPVFVSTRTPGSGAPMQRLTIAQDTGGAIR
FT                   GAVRADYFFGNGQAAATNARRMKERGQLWILLPRGLAVAQAAVSSAIRTRGAAVGAGLP
FT                   QCLVPTEGQCVDD"
     atgcatacct cttcacagtc gccacgcttc actggctcca cgctgatccg atgggccgcc        60
     ttcgcagccg tcgcgtcgct cgcgggctgc gtcaacccgc cgccagcggc caccaccgcc       120
     gacacgacgg ccgcgaccga cacgtcgtcg accaccagtt cgcgccccgc ctccaccggc       180
     gccagcgtgg ccggccaggc gcgcaccttc tcgacgcaac tcgccaccta caccgcggtg       240
     agcttcgatg cgatgccggg ctggtcgcgc gacgacttct ccgagacctg gcccgcgttc       300
     ctcggcagct gcaaggtgct cacaggccgc ggcgccgagt ggaaagaggt gtgcgatcgc       360
     gccggcaagg tcgacggcaa aaaccgcaac gccatccgcg gcttcttcga gagcgagttc       420
     tcggcctacc agatccgcga cgacgaccgc aagcccgatg gcgtggtcac cggctacttc       480
     gagcccgaga tcgcgggcag ccgcacctac ggcgcgccgt tcatctaccc cgtgtacggc       540
     cagccggaag acatgctgtt cgccgatgcg cggaagctcc cggccggcag cggcacggtg       600
     gccgcgaagg tcgaaggccg caacgtggtc gtgcagacgg gcctgagcac gcgcgacatg       660
     ggcgcgcccg gcctctatgc gctcgacctc tcggccatca cccgcgacac gctggaccgc       720
     aaggtgcgca tgcgcatcga gggcaagcag ctgctgccgt actacacgcg tgaagagatc       780
     gagaccaagg gcgcgcccaa cgccaaggtg ctggccttcg tgagcagcgc caccgcgctc       840
     tacgagatgc agatccaggg ctcgggccgc atcaagctgg ccaatggcga cacgattcgc       900
     gtggcttatg ccgagcagaa cggccagccg ttccgcccca ccatcgcgca ggccgccaac       960
     ggcaagccgc gcagcgcggt gaaggtgcgc ggttcgtcga tcgaactgca actcgacgac      1020
     ggcgacgacg acgatgtcgg cagcgtcgac agcagcgtca tccgcacgcg cggcttcacg      1080
     cttgcacggc ccaccgccag cggcgcggtc gtggtgccgg gtcgccgcac ggctggcgcg      1140
     gtggcgggtt cgggcatcaa ggacccgagc tacgtgttct tcaaggaagc gacctcgccc      1200
     gcgggcggac cggtcggcgc cttcggtgtg ccgctgtcgg caggccgttc cattgcggtc      1260
     gatccgcgca gcacgccgct cggctacccg gtgttcgtct cgacgcgcac gcccggcagc      1320
     ggcgcgccga tgcagcgcct gaccatcgcg caggacaccg gcggcgcgat ccgcggtgcg      1380
     gtgcgcgccg actatttctt cggcaacggc caggccgccg cgaccaacgc gcgccgcatg      1440
     aaggagcgcg gccagctctg gattcttctg ccgcgcggcc tcgccgtcgc acaggccgcg      1500
     gtgtcgtcgg cgatccgcac gcgcggcgcc gcggtgggcg cgggcttgcc gcagtgcctg      1560
     gtgccgaccg aaggccagtg cgtggatgac tga                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page