(data stored in ACNUC1104 zone)

EMBL: CP002417.PE556

CP002417.PE556       Location/Qualifiers
FT   CDS_pept        619372..620121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34779"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0521"
FT                   /protein_id="ADU34779.1"
FT                   /translation="MQETLSSAESTELVRLWRRRQTLSSNDMGTMYRIVGDALVACNPP
FT                   ELQILGEGRQELVAQFIYVKVLRLDADPDEADERASHSAPSTAFALCAYFRRYLIDCTR
FT                   ASSFRRKLSIGDQITEAQLEDEIGAGDDLEGCLAEHGLSAQAVQLAARAFIAELPEPER
FT                   ILLCEGFGKEAEGGLSGIASRHAIASYHYRAGRLGLVHKREGLTADYAKTRLGGWIQQT
FT                   LGIAIEAENMAAILQVFKILGAEASYA"
     atgcaggaaa cactgtcgtc cgcagagagc actgaactcg tccgcctctg gcggcgcagg        60
     cagacgctgt cctcgaacga catgggcacc atgtaccgca tcgttggcga tgcgctcgtg       120
     gcctgcaatc cgcccgagct gcagatcctg ggcgaagggc ggcaggagct cgtggcgcag       180
     ttcatctatg tgaaggtgct gcggctcgat gccgatccgg acgaggccga cgagcgcgcg       240
     agccacagcg cgccctcgac cgccttcgcg ctctgcgcgt acttccggcg ctacctgatc       300
     gactgcacgc gggcgagctc tttccgacgc aagctctcca tcggcgacca gatcaccgag       360
     gcgcagctcg aagacgagat cggtgccggc gacgacctcg agggctgcct cgccgaacac       420
     ggcctgagcg cacaggcggt gcaactggcc gcgcgcgcct tcatcgccga actgcccgag       480
     cccgagcgca tcctgctgtg cgagggcttc ggcaaggagg ccgaaggcgg gctctcgggc       540
     atcgcctcgc gccatgccat tgcctcgtac cactaccgcg cggggcgcct gggcctcgtg       600
     cacaagcgcg agggcctcac cgccgactac gccaagaccc gcctgggcgg ctggatccag       660
     cagaccctgg gcatcgccat cgaggcggaa aacatggcgg cgatcctgca ggttttcaaa       720
     atcctcggtg ctgaagcgtc ttatgcctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page