(data stored in ACNUC1104 zone)

EMBL: CP002417.PE557

CP002417.PE557       Location/Qualifiers
FT   CDS_pept        620150..621304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34780"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0522"
FT                   /protein_id="ADU34780.1"
FT                   /translation="MNTELWPPLSVIRNAFETGHAAVPDAAAAGVATVAMPGTTSQATP
FT                   QAAPAAAPVLQDLLLPLTELARRREAVAQRGFTARWAPGRLLSVLHEGRLLGVLLDRCI
FT                   HGDLWQGWMAAGEADWASAFDVLLEPDDEPFEPAFGLIQAWNVLTLEPSPQLCARVLGE
FT                   VSATRLAAIRAVHDEWAAQKVLPIAPEPGHIALRTVGGVFSVLSGTPLGARDPRADYQA
FT                   LYRTVGLQLGSALTPSAKAAPAAPVPPRARPQERPEGGWWGSIRRWFGADGWMRPAFAV
FT                   LALCVVVQNVGLLGGRGSEEDEVRFRNVPTAPAAASANLVVRWKDGVRVDEADRLLRTM
FT                   SAEVVGGPGTNGVWRLRVDDPVGGLSMLAASPLVESAGPASERP"
     atgaacaccg aactctggcc cccgctcagc gtgatccgca acgcgttcga aaccggccac        60
     gccgccgtgc ccgatgcagc agccgctggc gtggccacgg tggccatgcc gggcaccacg       120
     tcccaggcca cgcctcaagc cgcacccgcg gcagcgcccg tgctgcagga tctgctgctc       180
     cctctcaccg aattggcccg gcgccgcgag gctgtcgccc agcgcggctt taccgcacgc       240
     tgggcgccgg gccgcctctt gagcgtgctg cacgaagggc ggctgctcgg cgtgctgctg       300
     gaccgctgca tccacggcga tctctggcag ggctggatgg ccgcgggcga ggccgattgg       360
     gcttctgcct tcgacgtgct gctcgaaccc gacgacgaac ccttcgagcc ggccttcggc       420
     ctcatccagg cctggaacgt gttgacgctc gagcccagcc cgcaactgtg cgcgcgcgtg       480
     ctcggcgaag tctcggccac gcggctcgcg gcgatccgcg cggtgcacga cgagtgggcc       540
     gcgcagaagg tgctgcccat cgcgcccgag cccggccaca tcgcgctacg caccgtgggc       600
     ggcgtgttct ctgtgctctc gggcacgccg ctcggcgcgc gcgacccgcg cgccgactac       660
     caggcgctgt accgcaccgt cggcctgcaa ctgggctcgg cgctgacgcc atcggccaag       720
     gctgcaccgg ccgcacctgt tcctccacgc gcccggccgc aggaacggcc cgagggtggc       780
     tggtggggca gcatccgccg ctggttcggc gccgatggat ggatgcgccc ggcgttcgcg       840
     gtgctcgcgc tgtgcgtggt ggtgcagaac gtgggactgc tcggcgggcg tggatcggaa       900
     gaggacgagg tgcgctttcg caacgtgccg accgcgcctg cggcggcgtc ggccaacctg       960
     gtcgtgcgct ggaaagatgg cgtgcgcgtc gacgaggccg accgcctgct gcgcacgatg      1020
     tcggctgaag tggtcggcgg gccgggcacg aacggcgtct ggcgcttgcg cgtggacgat      1080
     ccggtcggcg ggctgtcgat gctcgcggcc tcgccactgg tcgaatcggc cgggccggct      1140
     tcggagcggc catga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page