(data stored in ACNUC1104 zone)

EMBL: CP002417.PE558

CP002417.PE558       Location/Qualifiers
FT   CDS_pept        621430..623403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0560"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: vap:Vapar_0523 peptidase C14 caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34781"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H5"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ADU34781.1"
FT                   /translation="MRALCLRLLLSLALLVSGSTAFATQRALLVGVSELVNQPQALWLQ
FT                   APRNDVMLMRDALLKQGFAPADITVLADGVSGSVLPESQAIHEALGRLLAQSKSGDFVL
FT                   LYFSGHGTRLRDSNKRYQEPDGLSENFLARDVRGTLGADSALTGDLRDADFDAWIQAFL
FT                   ARNVFVASVFDTCSANSMTRSTTDAPAIADGPPGDEVRWRGLRTAQLVGAPGPAARVAM
FT                   TRPTVTDPVPRARYVALFASESHQITPELRLPRKNRNARPQGLLTWAVVEALSRKPATW
FT                   RDLFDGVLAVYPPVIDELAQRFPTRELPSPVAEGNLDAPIFANRAQAVTTRPVWRAQRS
FT                   GDTLTLQAGQLDGLVVQQPLRVLATMDDGTVRSAEGTLAQAFNDKARMAVPAALRELSG
FT                   AALWNITPLGEPATVALRVRAEQGLPPGLSLEYPASVIAVNETDGADARWSAGRLEVLS
FT                   PMLGAGAKSAPADAAVARRRLEVLARLKWLNQLYTIARDAQFDGFDAVFEIWNGDRLVR
FT                   SGSAQQVDAKLLPLRSGERAVLNVRNTSARSVDLVIVGIDPQGAARQVYPEDPGETNRF
FT                   KRGTREAPAVKRFELPWFNAEGGRLLVLATPAAPYSAPRLFGTGAGDAVAEVRVRGALQ
FT                   PESERQTFAAMVHWAGEVSAAK"
     atgcgggcgc tttgcttgcg gctgttgttg tcgctcgcgc tgcttgtctc cggcagcacc        60
     gccttcgcca cccaacgcgc cctgctcgtc ggcgtctccg aactcgtcaa ccagccgcaa       120
     gccctctggc ttcaggcacc gcgcaacgac gtgatgctga tgcgcgatgc gctcctgaag       180
     caaggcttcg cgcccgccga catcaccgtg ctcgccgacg gcgtgagcgg ctccgtattg       240
     cccgaatcgc aggccatcca cgaagccctc ggccgcctgc ttgcgcagtc gaagagcggc       300
     gatttcgtgc tgctctattt ctccggccac ggcacgcgtc ttcgcgacag caacaagcgc       360
     taccaggagc ccgacggcct ttccgagaac ttcctcgcgc gcgatgtgcg cggcaccctc       420
     ggcgccgaca gcgccctgac cggcgacctg cgcgatgccg acttcgacgc ctggatccag       480
     gcctttcttg cgcgcaacgt gttcgtcgct tccgtcttcg acacctgctc ggcgaactcg       540
     atgacgcgca gcacgaccga tgcgcctgcc atcgccgatg gtccgcccgg cgacgaggtg       600
     cgctggcggg gcctgcgcac cgcgcaactc gtcggcgcgc ccggccccgc ggcgcgcgtg       660
     gccatgacgc gccccaccgt caccgacccg gtgccgcgcg cccgctacgt cgcgctcttc       720
     gcttcggaga gccaccagat cacgcccgag ctgcgcctgc cgcgcaagaa ccgcaatgcg       780
     cgtccgcagg gccttctgac ctgggccgtg gtggaggcgc tctcgcgcaa gcccgccacc       840
     tggcgcgatc tgttcgacgg ggtgctggcc gtttatccgc cggtgatcga cgaactcgcg       900
     caacgctttc ccacgcgcga gctgccttcg ccggtcgccg agggcaatct cgacgcgccg       960
     atcttcgcca accgcgcgca ggccgtgacg acgcgtcccg tgtggcgcgc gcagcgctcg      1020
     ggcgacacgc tcacgctgca ggccggccag ctcgatgggc tcgtggtgca gcagccgttg      1080
     cgcgtgctgg ccacgatgga cgacggcacc gtgcgcagcg ccgaaggcac gctcgcgcag      1140
     gccttcaacg acaaggcgcg catggcggtg ccggccgcgc tgcgcgaact gtccggtgcc      1200
     gcgctctgga acatcacgcc gctcggcgaa ccggccactg tcgcgctgcg cgtgcgtgcg      1260
     gagcagggct tgccgcccgg tctcagcctc gagtaccccg cgtcggtcat cgccgtgaac      1320
     gagacagatg gcgccgatgc gcgctggtcc gccggccggc tcgaagtgct ctcgccgatg      1380
     ctcggcgccg gcgcgaaatc cgcacccgcc gatgccgccg tcgcgcgccg ccgcctcgaa      1440
     gtgctggccc gcctcaagtg gctcaaccag ctctacacca tcgccaggga cgcgcagttc      1500
     gacggcttcg acgcagtgtt cgaaatctgg aacggcgacc ggctcgtgcg cagcggctcc      1560
     gcgcagcagg tcgacgcgaa gctccttccg ctgcgaagcg gcgagcgcgc cgtgctcaac      1620
     gtgcgcaaca ccagcgcgcg ctcggtggac cttgtcatcg tcggcatcga cccgcagggc      1680
     gctgcgcgcc aggtctaccc cgaggacccg ggcgagacca accgcttcaa gcgcggcacg      1740
     cgcgaggcgc ccgccgtcaa gcgcttcgag ctgccctggt tcaacgccga aggcggccgg      1800
     ctgctggtgc tggccacgcc cgcggcgccc tacagcgcgc cgcgactgtt cggcacgggc      1860
     gcgggcgatg cggttgccga agtgcgcgtg cgcggcgcgc tgcaacccga gagcgagcgg      1920
     cagaccttcg ccgcgatggt tcattgggcg ggcgaagtct cggccgccaa gtag            1974
//

If you have problems or comments...

PBIL Back to PBIL home page