(data stored in SCRATCH zone)

EMBL: CP002417.PE559

CP002417.PE559       Location/Qualifiers
FT   CDS_pept        623463..624020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34782"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H6"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0524"
FT                   /protein_id="ADU34782.1"
FT                   /translation="MSWTYDGKLDPDEALRLLDYLSGESGNDFSMMIESKGTPIEGESV
FT                   RTYEDGKQRMDIGGYSYKSDVVIPPGSSKGKLRNYSFIVIRDCDAATASIASLMKSQDA
FT                   DLKVTVSVFKAGGDSSKDLQSHLEFVLEGARVNCHAIVTGGTPKRPCDIIFFDYTKLEI
FT                   RSAPQQKTGARGAVRTCTFTGN"
     atgagctgga cctacgatgg aaaactggac cccgacgagg ccctgcgcct gctcgactac        60
     ctgtcgggcg aatcgggcaa cgacttctcg atgatgatcg agagcaaggg cacgccgatc       120
     gagggcgaat ccgtgcgcac ctacgaagac ggcaagcagc gcatggacat cggcggctac       180
     tcgtacaagt ccgacgtggt catcccgccc ggctccagca agggcaagct gcgcaactac       240
     tccttcatcg tgatccgcga ctgcgatgcg gccacggcct ccatcgcgag cctgatgaag       300
     agccaggacg ccgacctcaa ggtgacggtg tcggtcttca aggccggcgg cgacagctcg       360
     aaggacctgc agtcgcacct ggaattcgtg ctcgaaggcg cgcgcgtgaa ctgccacgcc       420
     atcgtgaccg gcggcacgcc caagcggccc tgcgacatca tcttcttcga ctacacgaag       480
     ctggagatcc gctcggcgcc gcagcagaag accggcgcgc gcggcgccgt gcgcacctgc       540
     accttcacgg ggaactga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page