(data stored in SCRATCH zone)

EMBL: CP002417.PE56

CP002417.PE56        Location/Qualifiers
FT   CDS_pept        58330..59223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0056"
FT                   /product="peptidoglycan-binding domain 1 protein"
FT                   /note="KEGG: vap:Vapar_0051 peptidoglycan-binding domain 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34279"
FT                   /db_xref="GOA:E6UXT5"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0051"
FT                   /protein_id="ADU34279.1"
FT                   /translation="MKFTQFPLAAIAVGALLLTGCAATDMQMGSQSAKTMATGSAAGSA
FT                   TAGESSQLERCESPLGTVSLIENQSAGWYTILTGEYRLPPTANLLRLLVQQSNCFIVVE
FT                   RGAAGMNAMTRERALQQSGEMRGGSNFGRGQMVASDYGLSPEIVFSNSDAGGIGGALGG
FT                   LVGGGRGRALAAIGGSMQTKEASALLTLIDNRSGVQVAASEGSASKTDFGAFGGLAGRS
FT                   GAGGLGGYTNTAQGKVIAAAFMDAFNQMVRSLRNYKAQTVRGQGLGGGGRLGVDGGAAP
FT                   SQTYVPPEQAPARRRK"
     atgaagttca cccaattccc actcgcggcc atcgccgtcg gcgcgcttct cctcaccggt        60
     tgcgccgcca ccgacatgca gatgggcagc cagtcggcca agaccatggc caccggcagc       120
     gccgccggtt cggccaccgc cggcgagagc agccagctcg agcgctgcga atcgccgctc       180
     ggcacggtgt cgctgatcga gaaccagagc gcgggctggt acaccatcct caccggcgaa       240
     taccgcctgc cgcctactgc aaatctgttg cgtttgctgg tgcagcagtc gaactgcttc       300
     atcgtggtcg agcgcggcgc ggccggcatg aacgccatga cgcgcgagcg cgcactgcag       360
     cagtcgggtg aaatgcgcgg cggcagcaat ttcggccgcg gccaaatggt cgcttccgac       420
     tacggcctgt cccccgagat cgtgttcagc aacagcgatg ccggcggcat cggcggcgca       480
     ctcggcggct tggtgggtgg cggccgtggc cgtgcgctcg cagccatcgg cggcagcatg       540
     cagaccaagg aagccagcgc gctcctgacc ctcatcgaca accgctcggg cgtgcaggtt       600
     gcagcctccg aaggcagcgc ctccaagacc gacttcggcg ccttcggtgg actggccggg       660
     cgcagcggcg ccggtggcct cggcggctac accaacacgg cgcagggcaa ggtgattgct       720
     gccgcgttca tggacgcctt caaccagatg gttcgttcgc tgcgcaacta caaggcgcag       780
     acggtgcgtg gccagggcct cggcggcggc ggccgtctcg gcgtcgatgg cggtgcggca       840
     ccttcgcaga cttatgtgcc gccagagcag gcgccggcgc gtcgccgcaa gtaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page