(data stored in ACNUC1104 zone)

EMBL: CP002417.PE560

CP002417.PE560       Location/Qualifiers
FT   CDS_pept        624022..624876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0562"
FT                   /product="virulence protein SciE type"
FT                   /note="PFAM: virulence protein SciE type; KEGG:
FT                   vap:Vapar_0525 virulence protein SciE type"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34783"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H7"
FT                   /inference="protein motif:PFAM:PF07024"
FT                   /protein_id="ADU34783.1"
FT                   /translation="MATSSAELIKSADPVAALKALSDEVRAKPSDSKHRVFMAQLLCVL
FT                   GQWERALNQLTVAAELDALAVPMKQVYGDAVRCEGLRAEVFAGTRTPMIFGQPDEWLAL
FT                   LIESLLRQGRGESELAEDLRQRAFDGAPAIAGTIDGTPFEWLADADMRLGPVLEAFVNG
FT                   KYYWIPYARLAHIKIEPPEDLRDCVWMPAHLQFENGGETLALIPTRYEGSEKSEDGELQ
FT                   LARKTEWRELRPEVWAGTGQRVLGSDAGEYALMDVREILFNPVASAEAEAAPSQEGTES
FT                   AGG"
     atggccacct cttccgccga actcatcaag tccgccgacc ccgtggcggc gctcaaggcg        60
     ttgagcgacg aggtgcgcgc caagccctcc gacagcaagc accgcgtgtt catggcgcag       120
     ctgctctgcg tgctggggca gtgggagcgc gcgctcaacc agctcacggt cgcggccgag       180
     ctcgatgcgc tcgccgtccc gatgaagcag gtgtacggcg atgccgtgcg ctgcgagggc       240
     ctgcgcgccg aggtgttcgc cggcacgcgc acgccgatga tcttcggcca gcccgacgaa       300
     tggctggcgc tgctcatcga gtcgctgctg cggcaggggc gcggcgagtc cgagctggcc       360
     gaggacctgc gccagcgcgc cttcgacggt gcgcccgcca tcgcgggcac catcgacggc       420
     acgcccttcg agtggctggc cgatgccgat atgcgcctgg gccccgtgct cgaagccttc       480
     gtcaacggca agtactactg gattccgtat gcgcggctcg cgcacatcaa gatcgagccg       540
     cccgaggacc tgcgcgactg cgtctggatg cccgcgcacc tgcagttcga gaacggcggc       600
     gaaaccctcg cgctcattcc cacgcgctac gaaggttccg agaagagcga agacggcgag       660
     ctgcagctcg cacgcaagac cgagtggcgc gagctccgtc ccgaggtgtg ggccggcacc       720
     ggccagcgcg tgctcggcag cgatgccggc gagtacgcgc tcatggacgt gcgcgagatc       780
     ctcttcaacc cggtcgcttc cgccgaagca gaagcagcac cttcgcagga aggcaccgaa       840
     agcgcgggcg gctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page