(data stored in SCRATCH zone)

EMBL: CP002417.PE561

CP002417.PE561       Location/Qualifiers
FT   CDS_pept        624878..625393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0563"
FT                   /product="type VI secretion system lysozyme-related
FT                   protein"
FT                   /note="KEGG: vap:Vapar_0526 type VI secretion system
FT                   lysozyme-related protein; TIGRFAM: type VI secretion system
FT                   lysozyme-related protein; PFAM: GPW/gp25 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34784"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H8"
FT                   /inference="protein motif:TFAM:TIGR03357"
FT                   /protein_id="ADU34784.1"
FT                   /translation="MGELTAQERLQPSLLDRLVDNAPTEKREGDEKRTLTKQALRAAVL
FT                   RDLSWLFNATGFGLAMDDKQYPNAARSVINYGLPMLSGQFTSSVQRVSMEQALKNAILQ
FT                   FEPRILSRTLEVELVMEGSAMDSHNSIGLQIRGMLWAQPVPLEFLMRSRVDLEEGRIEI
FT                   VDMAQNPR"
     atgggcgagc tcaccgcgca ggagcgcctg cagccctcgc tgctcgaccg cctggtcgac        60
     aacgcgccga ccgaaaaacg cgagggcgac gagaagcgca cgctcaccaa gcaggcgctg       120
     cgcgcggccg tgctgcgcga cctgagctgg ctcttcaacg ccaccggttt cgggctcgcg       180
     atggacgaca agcagtaccc gaatgcggcg cgctcggtca tcaactacgg attgcctatg       240
     ctgtctggcc agttcacctc gtcggtgcag cgtgtcagca tggaacaggc tttgaagaac       300
     gcaatcctgc agttcgagcc gcgcattttg tcccgcactc tcgaagtgga actcgtcatg       360
     gaaggctcgg caatggactc gcacaacagc atcgggctgc agatccgcgg catgctgtgg       420
     gcgcaacccg taccgctcga gttcctgatg cgaagccgtg tagacctgga agaaggacgc       480
     atcgagatcg tggacatggc gcaaaaccca aggtaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page