(data stored in ACNUC1104 zone)

EMBL: CP002417.PE562

CP002417.PE562       Location/Qualifiers
FT   CDS_pept        625402..627294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0564"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="KEGG: vap:Vapar_0527 type VI secretion protein,
FT                   VC_A0110 family; TIGRFAM: type VI secretion protein,
FT                   VC_A0110 family; PFAM: protein of unknown function DUF879"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34785"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H9"
FT                   /inference="protein motif:TFAM:TIGR03359"
FT                   /protein_id="ADU34785.1"
FT                   /translation="MDPRLLNLYEQELRYFRESSSEFARAFPKIAHRLGIEGQEVADPY
FT                   VERLIEATAFLSARVNLKLDAEYPRFTGHLLDIVYPNFLAPTPAMAVVSFSPDLDDANL
FT                   ATGPKLPRGAGLRARQAVGQNTHCEFRTSSALRIWPMEVQRAQYFTYAPDLPLATHPQS
FT                   RAIRGGLRIALRATAGLKFNQIALDDLVLHLGGAEDVAWQLQECALGQPIGVMVRPLSP
FT                   TGALQGAAQSLPASAIQPVGFEDDEALLPVTATGFSGFRLLQEYFAFPQRFQFLRIAGL
FT                   QALLATMPVTEIELVLLFSRGDAALEKLVTAENVQLHCVPVVNLFNKRLDRVPLTEGVS
FT                   QFHLVPDRTRPQDFEVHTVTEVIGHGAPGADATAAEQPFRPFYSAFHGTRHNHPAYFTT
FT                   TREPRMLSVRQRTEGHRSSHIGSEVYMQIVDPQQAPYAATLRQLAVSAMCTNRDLPLLM
FT                   PLGRDNDFDCVDSFPVQRVRMVRGPSRPVSPVVSQGLGWRVVDHLALNYLSISDSTPEQ
FT                   GAAALRETLMLYATHADEMRQGQVRGLLSVKSKPVARRLPLKGPIAFGRGLEVTLEVDK
FT                   DAFHGHSVFLFGAVMSRFLARHVEVNHFVETVLRVAGKGETMRWRPLCGTRQIL"
     atggaccctc ggctgctgaa cctgtatgaa caggaactgc gctacttccg cgaaagctct        60
     tcggagtttg cgcgcgcgtt tccgaagatc gcgcaccggc tgggcatcga gggccaggag       120
     gtcgccgacc cgtatgtcga gcggctgatc gaggccacgg ccttcctgtc ggcgcgcgtc       180
     aacctcaagc tcgatgccga gtacccgcgc ttcacggggc acctgctcga catcgtctat       240
     ccgaactttc ttgcacccac gcccgcgatg gcggtggtgt ccttctcgcc cgacctcgac       300
     gacgccaacc tcgcgaccgg ccccaagctg ccacgcggcg ccggcctgcg tgcgcgccag       360
     gccgtggggc agaacacgca ctgcgaattc cgcacatcga gcgcgttgcg catctggccg       420
     atggaggtgc agcgcgcgca gtacttcacc tacgcgcccg acctgccgct ggccacgcac       480
     ccgcaatcgc gcgccatccg cgggggcctg cgcattgcac tgcgcgcgac ggcggggctc       540
     aagttcaacc agatcgcgct cgacgacctc gtgctgcatc tgggcggtgc ggaagacgtg       600
     gcgtggcaac tgcaggagtg cgcgctgggc caacccatcg gtgtgatggt gcggcccctg       660
     tcgcccaccg gcgcattgca gggcgcggcg cagagcttgc cggccagcgc gattcagccg       720
     gtcggcttcg aggacgacga ggcgctgctg ccggtcacgg ccacgggctt ctcgggcttt       780
     cgtttgctgc aggagtactt cgcatttccg cagcgcttcc agttcctgcg catcgcgggg       840
     ctgcaggcgc tgctcgccac gatgccggtc accgagatcg agctcgtgct gctgttctcg       900
     cgcggcgatg cggcactcga aaagctggtg accgccgaga acgtgcagct gcactgcgtg       960
     ccggtggtca acctcttcaa caagcggctc gatcgcgtgc cgctcaccga aggcgtgagc      1020
     cagttccacc tggtgcccga ccgcacacgg ccgcaggact tcgaggtgca taccgtcacc      1080
     gaggtcatcg gccacggcgc gccgggtgcc gatgcgacgg ctgccgagca gccgttccgg      1140
     ccgttctact cggccttcca tggcacgcgg cacaaccacc ccgcgtactt cacgaccacg      1200
     cgcgagccgc gcatgctgtc ggtgcgccag cgcaccgagg ggcaccgcag cagccacatc      1260
     ggctccgagg tctacatgca gatcgtcgat ccgcagcagg cgccgtacgc ggccacgctg      1320
     cggcagctgg cggtgagcgc gatgtgcacc aaccgcgacc tgccgctcct gatgccgctc      1380
     ggccgcgaca acgacttcga ttgcgtcgac tctttcccgg tgcagcgcgt gcgcatggtg      1440
     cgcgggcctt cgcggccggt gtcgccggtg gtgagccagg ggctgggctg gcgggtggtc      1500
     gatcacctcg cgctcaacta cctttcgatt tccgacagca cgccggagca gggtgccgcc      1560
     gcgctgcgcg aaacgctgat gctctatgcc acgcatgccg acgagatgcg ccagggccag      1620
     gtgcgcggcc ttctctcggt gaagagcaag ccggtggcgc gccgcctgcc gctcaagggg      1680
     ccgatcgcat tcgggcgcgg gctcgaagtg acgctggagg tcgacaagga cgcgttccac      1740
     ggccacagcg tgtttctctt cggcgccgtg atgtcgcgct ttctcgcgcg ccatgtggag      1800
     gtcaatcact tcgtcgagac cgtgctgcgc gtggcgggca agggcgagac catgcgatgg      1860
     aggccgctgt gcgggacccg gcagattctg tag                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page