(data stored in ACNUC1104 zone)

EMBL: CP002417.PE563

CP002417.PE563       Location/Qualifiers
FT   CDS_pept        627258..628340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0565"
FT                   /product="type VI secretion protein, VC_A0111 family"
FT                   /note="KEGG: vap:Vapar_0528 type VI secretion protein,
FT                   VC_A0111 family; TIGRFAM: type VI secretion protein,
FT                   VC_A0111 family; PFAM: protein of unknown function DUF1305"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34786"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5I0"
FT                   /inference="protein motif:TFAM:TIGR03347"
FT                   /protein_id="ADU34786.1"
FT                   /translation="MEAAVRDPADSVATRVDNALRGWSAEPWSFDYFAVMRRLESVAAT
FT                   TPRWGRALLPSAEPVRVGQEPSLSFAPASFSRFEPATAYSPPRLRQHFFSYVGPNGPLP
FT                   VHLSDFIRERSLNHGDPTWLAFLDSFLHRFSLHFYRAWAQARPAVALDRPGEDRFRLQV
FT                   GAFVGMGTPGRIGRDEVHDDARLHFSGWLARRVHNAESVESVLRSYFGVPVTLERWVGH
FT                   WMRVPSDEVTRLGRGESSRSMGMGAMLGTRAWDRQHRVRLHMGPLTLDQYRMFLPIGTA
FT                   RPVLQRWMQQLLGDELEWDAELVLEKAEVPVTRLGQKNGNAPRLGWASWLGQRTRAKDA
FT                   ADVRIGSSSMTVRTAAGAAA"
     atggaggccg ctgtgcggga cccggcagat tctgtagcca cacgcgttga caacgcgctg        60
     cgcggatggt cggcagagcc gtggtcgttc gattacttcg cggtgatgcg ccggctcgaa       120
     tcggtggccg cgaccacgcc gcgctggggc cgcgcgctgc tgccgagcgc cgagccagta       180
     cgcgtggggc aggagccttc gctctcgttc gcacccgcga gcttcagccg cttcgagccc       240
     gcgaccgcct attcgccgcc gcgcctgcgc cagcacttct tcagctacgt gggccccaac       300
     ggcccgctgc cggttcacct gagcgacttc atccgcgagc gcagcctgaa ccatggtgac       360
     ccgacctggc tcgcgtttct cgacagcttt ttgcatcgct tctcgctgca cttctaccgc       420
     gcgtgggcgc aggcgcggcc cgcggtggcg ctcgaccggc cgggcgaaga ccgcttcagg       480
     ttgcaggtcg gcgcgttcgt cggcatgggc acgccgggcc gcatcgggcg cgacgaggtg       540
     cacgacgatg cgcgcctgca tttctcgggc tggctcgcgc ggcgcgtgca caacgcggag       600
     agcgtggagt cggtgctgcg cagctacttc ggcgtgccgg tgacgctgga gcgctgggtc       660
     ggccactgga tgcgcgtgcc atccgacgag gtcacgcggc tcgggcgggg cgagagttcg       720
     cgctcgatgg gcatgggcgc gatgctcggc acccgcgcgt gggaccggca gcaccgcgtg       780
     cgcctgcaca tgggcccgct cacgctggac cagtaccgca tgttcctgcc catcggcacc       840
     gcgcggccgg tgctgcagcg ctggatgcag caactgctgg gcgacgaact cgaatgggac       900
     gccgagctgg tgctcgagaa ggccgaggtg ccggtcacgc gcctcggaca gaagaacggc       960
     aacgcgccgc gcctgggctg ggcctcgtgg ctcggccagc gcacgcgtgc gaaggacgca      1020
     gcggacgtgc gcatcggcag cagctcgatg actgtccgga ccgctgcagg agccgccgca      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page