(data stored in SCRATCH zone)

EMBL: CP002417.PE564

CP002417.PE564       Location/Qualifiers
FT   CDS_pept        628337..629671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0566"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Tetratricopeptide
FT                   TPR_1 repeat-containing protein; KEGG: vap:Vapar_0529
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34787"
FT                   /db_xref="GOA:E6V5I1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5I1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU34787.1"
FT                   /translation="MTTTTLGCADTAAHAAALVQAADLTKAGNLDAADELLARILEAAP
FT                   DDPDALHYQGLLRHAQGRDAESIALIGRSLTLQPAQGGAWNNLGNLLVEAGRVDDAMRA
FT                   YENSVSFASGDEAADALSNIAMLERGKGHWQAAERASRRAIELRPTSSEAWYNLSIALM
FT                   EQGRIEESVIANSRAVLLQPRNMSARSKVIRALELLRESEQAIRMYREWLAEDPGNPVV
FT                   AHLLAACEGHAPARASDGYVETLFDSYAGSFDASLEKLHYRAPELVARAVRDMFGPPAA
FT                   RIAVVDAGCGTGLCAPLLRPWASHMAGCDLSVGMLQRAEQRGGYDVLHKAELTHYLHTQ
FT                   PGRFDLVASADTLCYFGDLHEVLAAAARALRPEGGVAFTVEAMDGGPNDFRLEGSGRYR
FT                   HAAAHVEACLAAAGFDAIRIEPIVPRREAGRNVQGWLASARLFAP"
     atgacgacga caacgctcgg gtgtgcagac acggcggcgc acgcggccgc gctggtgcaa        60
     gcggcggacc tgacgaaggc ggggaatctc gacgcggccg acgaactgct cgcccgcatt       120
     ctggaagccg cgcccgacga ccccgatgcc ttgcactacc agggcttgct gcgccatgcg       180
     caggggcgcg acgccgagag catcgcgttg atcgggcggt cgctcacgct gcaacccgcg       240
     caaggcggcg cctggaacaa cctgggcaat ctgctggtcg aggccggccg cgtcgacgat       300
     gcgatgcgtg cctatgaaaa cagcgtgtcc ttcgccagcg gcgacgaagc tgccgacgcg       360
     ctgagcaata tcgcgatgct cgaacgcggc aagggccact ggcaggccgc cgagcgcgcc       420
     agccgccgtg cgatcgaact gcggccgacg tccagcgagg cctggtacaa cctgtcgatc       480
     gcgctgatgg agcaggggcg catcgaggag agcgtcatcg ccaacagccg tgcggtgctg       540
     ctgcagccgc gcaacatgag cgcgcgctcc aaggtgattc gcgcgctgga gctgctccgc       600
     gagagcgagc aggccatccg catgtaccgg gagtggctgg ccgaagatcc aggcaatccc       660
     gtggtcgcgc atctgctggc cgcctgcgag gggcatgcgc ccgcgcgcgc cagcgacggt       720
     tatgtggaga cgttgttcga cagctacgcc ggcagcttcg acgccagcct cgagaagctg       780
     cactaccgcg cacccgaact ggtggcgcgc gcggtgcggg acatgttcgg cccgcccgcc       840
     gcgcgcatcg ccgtggtcga tgccggctgc ggcaccgggc tctgcgctcc gctgctgcgg       900
     ccctgggcct cgcacatggc cggctgcgac ctgtcggtgg gcatgctgca gcgcgcggag       960
     cagcgcggcg gctacgacgt gctgcacaag gccgaactca cccactacct gcacacccag      1020
     cccggccgct tcgacctcgt ggcatcggcc gacacgctgt gctacttcgg cgacctgcac      1080
     gaagtgctgg cggccgccgc gcgtgcgctg cgccccgaag gcggcgtggc gttcacggtc      1140
     gaggccatgg acggcggacc gaacgacttc aggctcgaag gcagcggccg ctaccgccat      1200
     gcggccgcgc atgtagaggc ctgcctcgcg gccgccggtt tcgacgccat tcgcatcgag      1260
     ccgatcgttc cgcgccgcga agcggggcgg aacgtgcaag ggtggctggc cagcgcaagg      1320
     ctttttgcgc catga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page