(data stored in ACNUC1104 zone)

EMBL: CP002417.PE61

CP002417.PE61        Location/Qualifiers
FT   CDS_pept        complement(62471..63082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0061"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   vap:Vapar_0057 lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34284"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU0"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADU34284.1"
FT                   /translation="MCGVPAAAALAACGKRKPSTAALKSDARVLAIGDSLTFGYGASPD
FT                   ASWPVKLGEITGWQVENAGVNGDTSAGALQRLPSLLAAGSYDGILIGIGGNDMLRGVSA
FT                   SATRDNIAALVKEAREHTPHVALLATPAPDAMRAFVGSLSDAPFYEEVAKSGQALLVAN
FT                   VYSSVLSDASLRSDRIHANAQGYAKVAQLLADQFKAAGWR"
     atgtgcggcg tgccggccgc ggccgcgctg gccgcctgcg gcaagcgcaa gccctccacc        60
     gctgcgctca aatccgatgc ccgcgtgctg gccatcggcg acagcctgac cttcggctat       120
     ggcgcatcgc ccgacgcgtc atggcccgtg aagctgggcg agatcaccgg ctggcaggtc       180
     gagaatgcgg gcgtcaacgg cgacacctcg gccggcgcat tgcagcgcct gccgtcgctg       240
     ctggccgcag gcagctacga cgggatcctg atcggcatcg gcggcaacga catgctgcgc       300
     ggcgtgtcgg cctcggccac gcgcgacaac atcgcggcgc tcgtgaaaga ggcgcgcgag       360
     cacacgccgc atgtcgcgct gttggcgacg cctgcgcccg atgcgatgcg tgcgttcgtc       420
     ggctcgctca gcgatgcgcc gttctacgaa gaggtcgcga agtcggggca ggcgctgctc       480
     gtcgccaatg tgtattcgag cgtgctgtcg gatgcgtcgc tgcgctcgga ccgcatccac       540
     gccaatgcac agggctacgc gaaggtcgcg cagctgctcg cagaccagtt caaggctgcg       600
     ggctggcgct ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page