(data stored in ACNUC1104 zone)

EMBL: CP002417.PE63

CP002417.PE63        Location/Qualifiers
FT   CDS_pept        63712..64302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0063"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: mlo:mll1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34286"
FT                   /db_xref="GOA:E6UXU2"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU2"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADU34286.1"
FT                   /translation="MRKLILQMQMSVDGYVSPANGNIDWQVWGWGDRWAWDDKLKAYFN
FT                   AVFEGVDTILLSRKIVEEGYLDHWGRAAKNYPANPQFAFAQKVVDAQKVVLTDKLEASR
FT                   WERTVIARGGMAEEVNALKREEGKDILVIGGVGFASSLVNEGLVDEFQFFVNPMAVGAG
FT                   RSVFHDQRKGHKLRLLGSVGYECGVVVNRYAPQ"
     atgcgaaagc tcatattgca gatgcagatg tccgtcgatg gctacgtctc gccggccaac        60
     ggcaacatcg attggcaggt ctggggttgg ggcgatcgct gggcctggga cgacaagttg       120
     aaggcgtact tcaacgctgt cttcgaaggc gtcgacacca tcctgctcag ccgcaagatc       180
     gtggaggaag gctacctcga tcactggggc cgcgcggcga agaactatcc ggccaacccg       240
     cagttcgcct tcgcgcagaa ggtggtcgat gcacagaagg tcgtgctcac cgacaagctc       300
     gaggcatcgc gctgggagcg caccgtcatc gcgcgtggtg gcatggccga agaggtgaat       360
     gcgctcaagc gagaggaggg caaggacatc ctcgtcatcg gtggtgtcgg cttcgcgtcg       420
     tcgctcgtga acgaagggtt ggtcgacgag ttccagttct tcgtgaatcc gatggccgtg       480
     ggcgccggtc gctcggtgtt tcacgaccag cgcaaggggc acaagctgcg cctgctcggg       540
     tcggttggct acgaatgcgg cgtcgtggtc aaccgctacg cgccgcagtg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page