(data stored in ACNUC1104 zone)

EMBL: CP002417.PE66

CP002417.PE66        Location/Qualifiers
FT   CDS_pept        complement(65348..66292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0066"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0061 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34289"
FT                   /db_xref="GOA:E6UXU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34289.1"
FT                   /translation="MNFQQLRSVREAVRCGFNLTEVAHTLHTSQPGVSRQIRELEEELG
FT                   IELFVRAGKRLTGLTEPGGHVLPIIERMLLESSNLRHAGQEFVAQQSGLLSIAATHSQA
FT                   RYAMPVAVQEFRAQFPNVKLHLHQGSPKQIAQMLIDGEADVGIATEALGDYPQLVALPC
FT                   YRWTHSVIVPPGHPLLDAPLSLEALTRYPLITYDTGFTGRSRIDEAFEARGLQPNIVLA
FT                   AMDADVIKTYVTLGLGVGIVAGVAYEAERDTQLRAIDAGRLFGINLTKLAVRRGNYLRK
FT                   YVYAFIESFAPTLTRAIVEKALGDEAKASHYEI"
     atgaacttcc aacaactgcg ctcggtacgc gaggccgttc gttgcggctt caacctgacc        60
     gaagtcgctc acacccttca cacctcgcag cccggcgtga gccggcagat ccgcgaactc       120
     gaggaagaac tcggcatcga gctcttcgtg cgcgccggca agcggctcac cggcctcacc       180
     gagccgggcg gccatgtgct gccgatcatc gagcgcatgc tgctggagag cagcaacctg       240
     cggcacgcgg ggcaggagtt cgttgcgcag caaagcgggc tgctctccat cgcggccacg       300
     cactcgcagg cgcgctatgc gatgccggtg gcggtacagg aatttcgcgc gcaattcccg       360
     aacgtgaaac tgcacctgca ccagggctcg cccaagcaga tcgcgcagat gctgatcgac       420
     ggcgaggccg acgtgggcat cgccaccgag gcgctgggcg actacccgca actggtcgcc       480
     ctgccctgct accgctggac ccattcggtg atcgtgccgc cgggccatcc gctgctcgat       540
     gcgccgctgt cgctggaggc gctcacgcgc tatccgctca tcacctacga cacgggtttc       600
     accggccgct cgcgcatcga cgaggctttc gaggcgcgcg ggctgcagcc caacatcgtg       660
     ctcgccgcga tggacgccga cgtgatcaag acctacgtga cgttgggcct gggcgtgggc       720
     atcgtggccg gcgtggcgta cgaagcggag cgcgacacgc agttgcgcgc gatcgatgcg       780
     gggcgcctgt tcggcatcaa cctcaccaag ctcgcggtgc gccgcggcaa ctacctgcgc       840
     aagtacgtct acgccttcat cgagtcgttc gcgccgaccc tgacgcgcgc catcgtcgag       900
     aaggctttgg gcgacgaagc caaggcttcc cactacgaaa tctag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page