(data stored in ACNUC1104 zone)

EMBL: CP002417.PE67

CP002417.PE67        Location/Qualifiers
FT   CDS_pept        66465..67067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0067"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vap:Vapar_0062
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34290"
FT                   /db_xref="GOA:E6UXU6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU34290.1"
FT                   /translation="MDAKTQKSELTRAAIVGAALDLALAEGLEAISLQVIASRLGLSKS
FT                   GVFSRVGSREALQKAVIEEYGRGFLADVFVPAMQKPKGLARLNEIVARWIARTRDVEAQ
FT                   TGCLYVAGAFEFDDREGELRDVLLGEITRWRAALRRTVTLAIEAGELKADTEPAQLVSE
FT                   INGIMMNQLHDARFLRDPHTADRAAQTWQRLLSSYLA"
     atggacgcca agacccagaa aagcgaactc acccgtgccg ccatcgtcgg cgccgcgttg        60
     gacctcgccc tggccgaagg cctggaagcg atctcgctgc aggtcatcgc gagccgtctg       120
     gggctttcca agagcggcgt cttttcccgc gtgggttcgc gcgaggcgct gcagaaggcc       180
     gtcatcgagg agtacggccg cggcttcctg gccgatgtgt tcgtgcccgc catgcagaag       240
     cccaagggcc tcgcgcgcct gaacgagatc gtggctcgct ggatcgcccg cacccgcgat       300
     gtcgaagccc agaccggctg cctctatgtg gccggcgcct tcgaattcga cgaccgcgaa       360
     ggcgagctgc gcgacgtgct cctcggagag atcacacgct ggcgcgcggc cctgcgccgc       420
     accgtgacgc tcgccatcga ggcgggagag ctcaaggccg acaccgaacc cgcgcagctg       480
     gtcagcgaga tcaacgggat catgatgaac cagctccacg acgcgcgttt cctgcgcgac       540
     ccgcacaccg ccgaccgggc cgcgcagacc tggcagcggc tcctttccag ctacctcgcc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page