(data stored in SCRATCH zone)

EMBL: CP002417.PE68

CP002417.PE68        Location/Qualifiers
FT   CDS_pept        67145..67258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34291"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXU7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0063"
FT                   /protein_id="ADU34291.1"
FT                   /translation="MLIIALCLAIYAVALGVETARDTLRSLPRSNQDWVWY"
     atgctgatca ttgccctttg ccttgccatc tatgccgtcg cccttggcgt cgaaaccgcc        60
     cgcgacacgc tgcgcagcct gccccgcagc aaccaggatt gggtctggta ctaa             114
//

If you have problems or comments...

PBIL Back to PBIL home page